KEGG   Ralstonia solanacearum PSI07: RPSI07_3056Help
Entry
RPSI07_3056       CDS       T01273                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00010  Glycolysis / Gluconeogenesis
rsl00260  Glycine, serine and threonine metabolism
rsl00680  Methane metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
rsl01200  Carbon metabolism
rsl01230  Biosynthesis of amino acids
Module
rsl_M00002  Glycolysis, core module involving three-carbon compounds
rsl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPSI07_3056 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    RPSI07_3056 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPSI07_3056 (gpmA)
Enzymes [BR:rsl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RPSI07_3056 (gpmA)
Membrane trafficking [BR:rsl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    RPSI07_3056 (gpmA)
Exosome [BR:rsl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RPSI07_3056 (gpmA)
  Exosomal proteins of melanoma cells
   RPSI07_3056 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBJ52409
UniProt: D8NZQ4
Position
3185192..3185947
Genome map
AA seq 251 aa AA seqDB search
MAVMHKLVLIRHGESTWNLENRFTGWVDVDLTDTGIAQARQGGRLLREAGFTFDLAYTSV
LKRAIRTLWHVQDEMDLMWIPTRTEWRLNERHYGGLSGLNKAETAAQYGDEQVLVWRRSY
DTPPPALEVGDERDAYGDPRYAGLSREQVPLTECLKDTVARVLPLWETAIAPDIKRGKRV
VIAAHGNSIRALVKYLDNISDNDIVGLNIPNGTPLVYELDANLKPIRHYYLGDQEAIAAS
LAAVASQGKAK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcatgcataagctcgtcctcatccgccacggcgaatcgacgtggaacctcgaa
aaccgcttcaccggctgggtcgacgtcgacctgaccgacaccggcatcgcccaggcccgc
caaggcggccgcctgctgcgcgaagccggcttcaccttcgacctggcgtatacctcggtg
ctcaagcgcgccatccgcacgctgtggcacgtgcaggatgaaatggacctgatgtggatc
ccgacccgcaccgaatggcggctcaacgagcgccactatggcggcctgtcgggcctgaac
aaggccgagaccgccgcccagtacggcgacgagcaggtgctggtctggcgccgcagctat
gacaccccgccgcccgcactggaagtcggcgacgagcgcgacgcgtacggcgacccgcgc
tatgcgggcctgtcgcgcgaacaggtgccgctcaccgaatgcctgaaggacaccgtggca
cgcgtgctgccgctgtgggaaacagcgatcgccccggacatcaagcgcggcaagcgcgtc
gtgatcgccgcgcacggcaacagcatccgcgccctggtgaagtacctggacaacatctcg
gacaacgacatcgtcggcctgaacatccccaacggcacgccgctcgtctatgagctggac
gccaacctgaagcccatccgccactactatctcggcgaccaggaagcgatcgccgcgtcg
ctcgccgccgtggcgagccagggcaaagcgaaataa

DBGET integrated database retrieval system