KEGG   Ralstonia solanacearum PSI07: RPSI07_mp0651
Entry
RPSI07_mp0651     CDS       T01273                                 

Definition
(GenBank) conserved hypothethical protein, Rhs element Vgr related protein (modular protein)
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RPSI07_mp0651
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rsl02044]
    RPSI07_mp0651
Secretion system [BR:rsl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RPSI07_mp0651
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V DUF4157 Sarcoglycan_1
Other DBs
NCBI-ProteinID: CBM10544
Position
mpPSI07:complement(798603..801947)
AA seq 1114 aa
MKSLFPVPAAVPQAVLGALLGQQTRQITLETALASDNLVVERFTAREAVSASFVLQVDCL
SPSAHLDTVRLASQEATLRLMLADGRRRAWHGYVVDCATLGGDGGLARYRLRIVPWLDRL
HTRGDCFVYQDKTALEIIEDLFADYPVAHYKLAVSQPCAKRSICCQYRETDYAFVMRLLA
EEGLSLRIEHEQRDERHDSSAQSRHCVVIFDNDAERPACAQPEIRFHRVDATERDDAIER
LSLTRTVGTNAVTVASWDYKALAATAAQATASDPGGELPTLEAFEASGPYCFANTEGASR
AARLRMQAHEGAYLRYAGIGSVRQLGAGQRFTLTQHFDTRHSAFVTLSVEHEAANNLGAD
LARLLGTTAIESGSYRNRFVAVPAEAPIVPPYQRRPTAPEGQAAVVIADDGAPLTTDRDH
RVRIRFPWLRAPSVNAFSDPAGSARSQVTAWVRVATASAGPNWGAHHLPRAGTQVLLTFV
DGDIDRPLATQQLHNAQDALPWPAADAPLGQALSGWHSQNLGGDGYNQWVVDDHPAQLRM
RLASSAASSQLNLGYVVSHGPTGGERGDWRGTGAELRTDAWAVVRAGGGLLLSTTARAQA
GGTLLDAKEARGQFIAAQRTAQRLSDAAASQQALPLAANEAFDPLTQALDPAQDGHYPSR
VNGQDATQPGSQSPVDKFAQPLLVAESPTSLALASQATTTVYAGRHLHGTAQGDWHLAAG
NVVAAAAAKGVSLFAQRNGIRVIAEGGSVSIQAHTDALAVMADQAVTVTSSTESVEILAQ
QNVVLRGGDSVIRMEGRAITFETQKLSVKGAGHPLIGPGGQAAELPGLPFGLLGATAAYD
EQIQFVNQHGEALPNVAYKILLADGTTVPGTTDKDGKTQRISTDKPTAIQTATLAPTEVI
DCCGRTNTGSIDPVKVPIADVTTNAVNVGGSVKTISVKGHDRPLTPGEIEMAKAIFKNSI
DYNKVRVHKGSYFWFNLQSKNTAVTPNGEMYFLAEDFEEDFSSPDGQAIYKRSWFMHEMT
HVWQYQKGYSVRWHGLTVTIHGESAYKYDIKPSNVFRDYNMEQQGNLVADYFALCILNNR
RAVLHDGYVGSPHELQQVLLPLLQDPENENNLPK
NT seq 3345 nt   +upstreamnt  +downstreamnt
atgaagtccttgttccccgtgccggccgccgtgccgcaagccgtcctgggcgcgctgctc
ggacagcagacccgccagatcacgctggagacagcgctggcctccgacaacctggtggtg
gagcgcttcacggcgcgcgaggcggtctcggcgtcgttcgtgctgcaggtcgattgcctg
agcccctcggcccacctggacacggtccggctggcctcgcaggaagccacgctgcgcctg
atgctcgccgatggccgccgccgcgcctggcacggctacgtggtcgactgcgcgaccctg
ggcggcgacggtggactggcgcgctaccggctgcgcatcgtgccctggctcgaccgcctg
cacacccgcggcgactgcttcgtctaccaggacaagacggcgctggagatcatcgaagac
ctcttcgccgattaccccgtcgcgcattacaagctcgcggtaagccagccgtgcgccaag
cgctcgatctgctgccagtaccgcgagaccgactacgccttcgtgatgcgcctgctggcc
gaggaagggctgtcgttgcgcatcgagcatgagcagcgcgacgagcggcacgacagcagc
gcgcaatcgcgccactgcgtcgtcatcttcgacaacgacgccgagcgccccgcgtgcgcg
cagcccgagatccgcttccaccgcgtcgatgccaccgaacgcgacgacgccatcgagcgc
ctctcgctgacccgcacggtcggcaccaacgccgtgaccgtggcttcgtgggactacaag
gccctggccgccaccgccgcccaggccaccgccagcgaccccggtggcgagctgccgacg
ctggaagcgttcgaggcatccggcccctactgcttcgccaataccgagggcgccagccgc
gccgctcggctgcgcatgcaagcccacgagggcgcctacctgcgctatgcgggcatcggc
agcgtgcgccagttgggcgccggccagcgcttcacgctcacccagcacttcgatacccgc
cacagcgccttcgtcaccctgtcggtcgagcacgaggccgccaacaacctcggcgccgac
ctcgcccgcctgctgggcaccaccgccatcgaatcgggcagctaccgcaaccgcttcgtc
gccgtgccagccgaggcgcccatcgtgccgccctaccaacgccgccccaccgcccccgaa
ggccaggccgccgtggtgatcgccgatgacggcgcgccgctcaccaccgaccgcgaccac
cgcgtgcgcatccgcttcccgtggctgcgcgcgccgtcggtcaacgccttctccgatccg
gccggcagcgcccgctcgcaggtcaccgcctgggtgcgtgtggcgaccgcatccgccggt
ccgaactggggcgcccatcacctgccgcgcgccggcacccaggtgctgctgaccttcgtc
gacggcgacatcgaccggccgctggccacccagcagctgcacaacgcgcaggacgcgctg
ccctggcccgccgccgatgcgccgctcgggcaggcgctgtccggctggcattcgcagaac
ctgggcggcgacggctacaaccagtgggtggtcgacgatcaccccgcccagctgcgcatg
cggctggccagctcggccgccagcagccagctcaacctcggctacgtggtctcgcacggc
ccgaccggcggcgagcgcggcgactggcgcggcaccggcgcggagctgcgcaccgacgcg
tgggccgtggtgcgggccggtggcggcctgctgctgtccaccacggcacgggcacaggcg
ggcggcacgctgctcgatgcgaaggaagcacgcggccagttcatcgccgcccagcgcacc
gcgcagcgcctgtccgacgcggcggccagccagcaagcgctgccgctggcggccaacgag
gcgttcgacccgctcacgcaggcgctcgatccggcccaggacggccactacccgagccgc
gtcaacggccaggacgccacccagcccggcagccaatcaccggtcgacaagttcgcccag
ccgctgctggtagcggaatcgcccaccagcctcgccctggcctcgcaggccacgaccacg
gtctatgcggggcgacacctgcacggcacggcccagggcgattggcacctggccgccggc
aacgtagtggcggccgccgcggccaagggggtgagcctgtttgcgcagcgcaacggcatc
cgcgtcatcgccgagggcgggtcggtatcgatccaggcgcataccgatgcgctggccgtg
atggcggatcaggcggtgacggtgacctcgtccacggaatcggtggagatcctggcgcag
cagaacgtcgtgctgcggggtggggattcggtgatccggatggaggggcgtgccatcacc
ttcgagacgcagaagctgtcggtgaagggggcggggcatccgttgattggaccggggggg
caggcggcggagttgccagggttgccgttcggcctacttggagcaacagctgcatatgat
gaacagattcagttcgtcaatcagcacggcgaagcgctgccgaatgtcgcgtacaagatt
ctattggctgatggaaccactgtccctggcaccacggataaagacggaaaaactcagcgc
atctcgactgataaacccaccgccatacaaactgcaactctggcaccaacagaagtaatc
gattgctgcggccgtaccaacacgggctcaatcgatccggtaaaagtacccatcgctgac
gtcaccaccaacgctgtcaatgttggggggtctgtcaaaaccatttcggtgaaaggtcac
gaccggccactaactcctggtgagattgaaatggcgaaggcaatctttaagaactccatc
gattacaacaaagtaagagtgcacaaggggagctacttctggttcaatctacaaagcaag
aataccgctgtcacgcccaatggggaaatgtatttccttgcagaagattttgaggaagat
ttttcgtcgcccgacggccaagccatatataagcgatcgtggttcatgcacgagatgacg
cacgtatggcaataccagaaagggtactccgtcagatggcatggccttacggtaacgatt
cacggagaaagcgcatataaatatgacatcaagcccagtaacgtatttcgcgattacaac
atggaacaacaaggaaatcttgttgctgactattttgcactatgcatactaaataacagg
cgcgccgttttacacgacggatatgtcggcagcccgcacgaactacagcaggtgctgttg
ccgctacttcaagacccagaaaatgaaaacaatcttccgaaatag

DBGET integrated database retrieval system