KEGG   Ralstonia solanacearum PSI07: RPSI07_mp0652Help
Entry
RPSI07_mp0652     CDS       T01273                                 

Definition
(GenBank) putative secretion system protein (EvpN-like)
  KO
K11892  type VI secretion system protein ImpK
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RPSI07_mp0652
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rsl02044]
    RPSI07_mp0652
Secretion system [BR:rsl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RPSI07_mp0652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU PGF-CTERM
Motif
Other DBs
NCBI-ProteinID: CBJ34997
Position
mpPSI07:complement(802006..802797)
Genome map
AA seq 263 aa AA seqDB search
MSATTTPSLFGGSASPAGNASADAHESSTHVRTLLDLLYDGFFMLFQLRNGQQPTSAEDF
LARVRAFLEDFDRGAKRLNVSAEDVFDAKYAFCAAVDETILSSNFSIRTAWERCPLQLEL
FGEQLAGETFFIKLEELRAHGAPRLQALEVFHMCLLLGFRGKYILEGPEKLAYLTARLGD
EISAIKGKRAAFAPHWLLPDKVAHRLKRETPLWIFGAVFALIALLGYIGLSSTLRTKTNE
TLEGYSQVIKLGPRFSHLTISLP
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctaccaccacgccttccctgttcggcggctcggcctccccggccggcaacgcc
tcggccgatgcgcatgaatccagcacgcacgtgcgcacgctgctggacctgctctatgac
ggcttcttcatgctcttccagttgcgcaacggccagcagccgaccagcgcggaagacttc
ctcgcccgcgtgcgcgccttcctggaagacttcgaccgcggggccaagcggctgaacgtg
tcggccgaagacgtgttcgacgccaagtacgcgttctgcgccgccgtggacgagaccatc
ctgtcgtccaatttctccatccgcaccgcgtgggagcgctgtccgctgcagctggagctg
ttcggcgagcagctcgccggcgaaacgttcttcatcaagctggaagaactgcgtgcccac
ggtgccccccgcctgcaggcgctggaggtattccacatgtgcctgctgctgggcttccgc
ggcaagtacatcctcgaagggccggagaagctggcctacctgaccgcacgcctgggcgac
gagatctccgccatcaagggcaagcgcgcggccttcgcgccgcactggctgctgccggac
aaggtggcgcaccggctcaagcgcgagacgccgctgtggatcttcggcgcggtgttcgcg
ctgatcgcgctgctggggtatatcggcctgtcatccacgctgcgcacgaagacgaacgag
acgctggaaggctattcgcaggtcatcaagctggggccgcgcttctcgcacctgaccatc
tcgctgccctga

DBGET integrated database retrieval system