KEGG   Ralstonia solanacearum PSI07: RPSI07_mp0660
Entry
RPSI07_mp0660     CDS       T01273                                 

Definition
(GenBank) putative Type VI secretion protein (DUF879)
  KO
K11896  type VI secretion system protein ImpG
Organism
rsl  Ralstonia solanacearum PSI07
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rsl02044]
    RPSI07_mp0660
Secretion system [BR:rsl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RPSI07_mp0660
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: CBJ35005
Position
mpPSI07:809027..810877
AA seq 616 aa
MEELLPYYERELAFLRRYSRDFAERYPKIAGRLAMSGDGCDDPHVERMIESFALLTARVS
KKLDDDYPEFTEALLEVLYPHYLRPFPSCSVVHFDVRGVAAQLSAPVQIPRGTFLTSRVV
RKVECRFRTAYDVTFAPVRIAAAAFERAVSAPSAVSLPKGATGAIALTLEYVGERGGFES
LPLDRLRVYMDGEPSFVAALGDALFLHTAAAYVEGDRPGVWTRLSGVPLHEVGFTEDEAL
IDCPARSHPAYRLLTEHFSFAEKFNFFDIDLAVVRRGLTPGVPVRRLVLHLVLKDVRSDS
HAARLLEGLQAEHLRLHCTPVVNLFQQKADPIRIEHTASAYPVVADSRRAHGFDIYSIDK
VHLVRETAAHEEVTEFRPFYSLHHGEEPGRAGHYWIARRNELVAQRSPGFETEISIVDTQ
FDPASPQTDTLSLTVTCTNRDLPSTLAFGQPDGDLSMEGSSIARSITFLRKPTPSMRLGG
GRAAQWRLISLLALNHLSLVQNGLPTLKEMLRLHDLPHSAISARQVEGIVGLDYAPATHW
LAGKPFATFVRGLEIRLTLDEDAFVGTGLHRFIRVLDHFFGLYVHINSFVQLIAVSRRSG
KELVRCAPRSGESILV
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggaagagctgctgccctattacgaacgagaactggccttcctgcgccggtactcgcgc
gacttcgccgaacgctacccgaagatcgcaggccggctcgccatgtcgggcgacggctgc
gacgatccacacgtcgagcggatgatcgagtcgttcgcgttgctgaccgcgcgcgtcagc
aagaagctggacgacgattaccccgaattcaccgaagcgctgctggaggtcctgtacccc
cattacctgcgcccgttcccgtcgtgctccgtggtgcatttcgatgtgcgcggcgtggcg
gcccagctcagtgcgccggtgcagattccgcgcggcaccttcctgacctcgcgcgtggtg
cgcaaggtcgagtgccgcttccgcaccgcctacgatgtcacctttgccccggtgcggatt
gccgcggccgccttcgagcgcgccgtgtccgcgccgtcggcggtcagcctgcccaagggg
gcgaccggtgcaatcgcgctgacgctggaatatgtcggtgagcgcggcggtttcgaatcc
ttgccgctcgaccggctgcgcgtctacatggatggcgagccctcgtttgtggccgcgctg
ggtgatgcgctgttcctgcataccgcggcggcctatgtggagggcgatcgcccgggcgtg
tggacccgcttgtccggcgtgcccctgcacgaggtcggctttacggaagacgaggcgctg
atcgattgtccggcgcgttcgcatccggcctatcggctgctgaccgagcacttcagcttt
gccgagaaattcaacttcttcgacatcgatctggcggtcgtgcggcgcgggctgacgccc
ggcgtgccggtccgccgcctggtgctgcacctggtcctgaaggacgtgcgcagcgactcg
cacgctgcccgcctgctcgagggcctgcaggccgaacacctgcgcctgcattgcacgccg
gtggtcaacctgttccagcagaaggccgatccgatccgcatcgagcataccgccagcgcc
tatccggtcgtggccgacagccgccgcgcgcacggcttcgacatctactcgatcgacaag
gtgcacctggtgcgcgagaccgccgcgcacgaggaggtgaccgagttccgcccgttctac
tcgctgcaccacggcgaggagcccgggcgcgcgggccactactggatcgcccggcgcaac
gagctggtggcgcagcgcagccccggcttcgagaccgagatttccatcgtcgatacgcag
ttcgacccggccagcccgcagaccgacacgctgagcctgaccgtcacctgcaccaaccgc
gatctgccgtccacgctggcgttcggccagccggacggcgacctgtcgatggaaggcagc
tccatcgcccgcagcatcacgttcctgcgcaagccgacgccgtcgatgcgcctgggcggc
ggccgtgcggcgcagtggcggctgatttcgctgctggcgctcaaccatctgtcgctggtg
cagaacgggctgccgacgctcaaggagatgctgcgcctgcatgacctgccgcacagcgcc
atttcggcgcggcaggtcgagggcatcgtcggtctcgactacgcgccggccacgcattgg
ctggccggcaagccgttcgccaccttcgtgcgggggctggagatccggctcacgctggac
gaagacgcctttgtcggcacgggcctgcatcgcttcatccgcgtgctggaccatttcttc
ggcctgtacgtccacatcaacagctttgtgcagctgattgcggtatcgcgccgcagcggc
aaggaactggtcagatgcgcaccccgcagcggcgaatcgatcctggtgtga

DBGET integrated database retrieval system