KEGG   Ralstonia solanacearum PSI07: RPSI07_mp0750Help
Entry
RPSI07_mp0750     CDS       T01273                                 

Gene name
mqo
Definition
(GenBank) malate:quinone oxidoreductase (Malate dehydrogenase [acceptor])
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00020  Citrate cycle (TCA cycle)
rsl00620  Pyruvate metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
rsl01200  Carbon metabolism
Module
rsl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPSI07_mp0750 (mqo)
   00620 Pyruvate metabolism
    RPSI07_mp0750 (mqo)
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     RPSI07_mp0750 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-ProteinID: CBJ35096
Position
mpPSI07:918489..920111
Genome map
AA seq 540 aa AA seqDB search
MVVCLAAFSAQAAETKKVDVLLVGGGIMSSTLGVWLHELEPDWSMMMVERLDGVAQESSN
GWNNAGTGHSALAELNYTPEKSNGKIDISKAVEINEGFQVSRQFWSYQVKNGVLKNPHSF
INSTPHMSFVWGDDNVRYLKKRYEALQASPLFRGMQYSDDYDQISKWVPLMMEGRDRSQK
VAATWMPVGTDVNFGEITRQFVGYLQSQPNFTLSLSSEVRDIKRNADGTWRVSYVNLKTG
GPQQDVDAKFLFIGAGGGALRLLQASGIPEARDFAAFPVGGSFLVTENPEIVNRHLAKAY
GKASVGSPPMSVPHLDTRVLDGKRIILFGPFATFSTKFLKNGSYLDLFSSTTTHNVMPML
HVGADEFPLVQYLAGQLMLSDDDRFNALKEYFPLAKKEDWRLWQAGQRVQIIQRDEAKGG
ILKLGTQIVKSKDNTIAGLLGASPGASTAAPIMLGVLETVFKDKLATPAWQQKVHQMIPT
YGTKLNDNPAKVYEEWVATADVLQLAPPPKIDLHVTSATPADKPAGAKSVKAKAAADIAL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
gtggtggtttgtctggcggcattctccgcgcaggccgctgagaccaagaaggtggatgtg
ctgctggtgggcggcggcatcatgagttcgacgctcggcgtctggctgcatgagctcgag
cccgactggtcgatgatgatggtcgaacgcctcgacggcgtcgcccaggaaagctcgaac
ggctggaacaatgccggcaccgggcattccgcgctggccgagctcaactacacccctgaa
aaatcgaacggcaagatcgacatttccaaggccgtcgagatcaacgaagggttccaggta
tcgcgccagttctggtcgtaccaggtcaagaacggcgtgctcaagaatccgcactcgttc
atcaattcgactccgcacatgagcttcgtgtggggcgacgacaacgtccgctacctgaag
aagcgctacgaggcactgcaggccagcccgctgttccgcggcatgcagtactcggacgac
tacgaccagatcagcaagtgggttccgctgatgatggaaggccgcgatcgctcgcagaag
gtcgccgccacctggatgccggtggggaccgatgtgaacttcggcgagatcacccgccag
ttcgtcggctacctgcagagccagcccaatttcaccctgtcgctgtcgagcgaagtgcgc
gatatcaagcgcaatgccgacggtacgtggcgggtgtcgtacgtcaacctgaagacgggc
ggtccgcagcaggatgtcgatgccaagttcctcttcatcggtgcgggcggcggtgcgctg
cgcctgctgcaggcttcgggcattccggaggcgcgcgacttcgccgccttcccggtcggc
ggctcgttcctggtcaccgagaatccggaaatcgtgaaccgccacctggcgaaggcgtac
ggcaaggcgtcggtcggctcgccgccgatgtcggtgccgcacctggatacccgtgtcctc
gacggcaagcggatcatcctgttcggaccgttcgcgacgttctcgacgaagttcctgaag
aacggctcgtacctggacctgttcagcagcaccaccacgcacaacgtcatgccgatgctg
catgtgggtgccgacgagttcccgctggtccagtacctcgcgggccagctgatgctgtcc
gatgacgaccgcttcaacgcgctgaaggaatacttcccgctcgcgaagaaggaagactgg
cgcctgtggcaggccggccagcgcgtgcagatcatccagcgcgatgaggccaagggcggc
atcctcaagctcggtacgcagatcgtgaagtcgaaggacaacaccattgccggcctgctc
ggcgcgtcgccgggtgcgtcgaccgcggccccgatcatgctgggcgtgctcgagacggtg
ttcaaggacaagctcgccacgcccgcctggcagcagaaggttcaccagatgatcccgacc
tacggcaccaagctcaacgacaacccggccaaggtctacgaggaatgggttgccaccgcc
gacgtgctgcaactggcgccgccgccgaagatcgacctgcacgtgacgtctgcgacgccg
gccgataagccggctggggcgaagtcggtcaaggccaaagctgcagctgacatcgcgctg
taa

DBGET integrated database retrieval system