KEGG   Ralstonia solanacearum CMR15: CMR15_10536Help
Entry
CMR15_10536       CDS       T02725                                 

Definition
(GenBank) putative apaG protein associated with Co2+ and Mg2+ efflux
  KO
K06195  ApaG protein
Organism
rsm  Ralstonia solanacearum CMR15
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CMR15_10536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: CBJ36745
UniProt: D8N601
Position
562052..562426
Genome map
AA seq 124 aa AA seqDB search
MSRYELTVQVRTRYLPEQSEPSQGQYAFAYTITIRNTGEVPSQLVSRHWVITDAESHVQE
VAGLGVVGHQPLLPPGESFEYTSWATIKTPVGTMRGEYFCVAEDGHRFEAPIPEFALAMP
RMLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgctacgaactcaccgtccaggtccggacgcgctacctgcctgagcaatccgag
ccctcgcagggccagtacgcctttgcctacaccatcaccatccgcaatacgggcgaggta
ccgagccagttggtctcgcggcactgggtcatcaccgacgcggaaagccacgtgcaggag
gtcgccggcctcggcgtggtcggccaccagccgctgctgccgccgggcgaatcgttcgag
tacaccagctgggcgaccatcaagacgccggtgggcaccatgcgcggcgaatacttctgc
gtggccgaagacggtcatcgcttcgaggcgccgatccccgagtttgcgctggcgatgccg
cgcatgctgcattga

DBGET integrated database retrieval system