KEGG   Ralstonia solanacearum CMR15: CMR15_11635Help
Entry
CMR15_11635       CDS       T02725                                 

Gene name
phaA
Definition
(GenBank) Acetyl-CoA acetyltransferase (beta-ketothiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
rsm00071  Fatty acid degradation
rsm00072  Synthesis and degradation of ketone bodies
rsm00280  Valine, leucine and isoleucine degradation
rsm00310  Lysine degradation
rsm00362  Benzoate degradation
rsm00380  Tryptophan metabolism
rsm00620  Pyruvate metabolism
rsm00630  Glyoxylate and dicarboxylate metabolism
rsm00640  Propanoate metabolism
rsm00650  Butanoate metabolism
rsm00900  Terpenoid backbone biosynthesis
rsm01100  Metabolic pathways
rsm01110  Biosynthesis of secondary metabolites
rsm01120  Microbial metabolism in diverse environments
rsm01130  Biosynthesis of antibiotics
rsm01200  Carbon metabolism
rsm01212  Fatty acid metabolism
rsm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CMR15_11635 (phaA)
   00630 Glyoxylate and dicarboxylate metabolism
    CMR15_11635 (phaA)
   00640 Propanoate metabolism
    CMR15_11635 (phaA)
   00650 Butanoate metabolism
    CMR15_11635 (phaA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CMR15_11635 (phaA)
   00072 Synthesis and degradation of ketone bodies
    CMR15_11635 (phaA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CMR15_11635 (phaA)
   00310 Lysine degradation
    CMR15_11635 (phaA)
   00380 Tryptophan metabolism
    CMR15_11635 (phaA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CMR15_11635 (phaA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CMR15_11635 (phaA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CMR15_11635 (phaA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsm04147]
    CMR15_11635 (phaA)
Enzymes [BR:rsm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CMR15_11635 (phaA)
Exosome [BR:rsm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CMR15_11635 (phaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt gag-asp_proteas ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CBJ37836
UniProt: D8NBJ8
Position
1707307..1708488
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAVRTAVGKFGGSLAKIPAPELGAAVIREALSRAKVAPDQVSEVIMGQVLTAG
SGQNPARQALIKAGLPDMVPGMTINKVCGSGLKAVMLAANAIVAGEADIVVAGGQENMSA
APHVLPGSRDGFRMGDTKLIDSMIVDGLWDVYNQYHMGITAENVAKQYGITREAQDAFAV
ASQNKAEAAQKSGRFNDEIVPILIPQRKGDPIAFAQDEFVRHGATLESMTGLKPAFDKAG
TVTAANASGLNDGGAAVVVMSAASAKELGLTPLATIRAYANAGVDPKVMGMGPVPASKRC
LSRAGWSVGDLDLMEINEAFAAQALAVHQQMGWDTAKVNVNGGAIAIGHPIGASGCRILV
TLLHEMQKRDAKKGLASLCIGGGMGVALAVERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgtagtgatcgtatcggcggttcgtaccgccgtgggcaagtttggcggttcg
ctggcgaaaatccccgcgccggagctgggtgcggccgtgatccgcgaagcgttgtcgcgc
gccaaggtggcgccggatcaggtcagtgaagtcatcatgggccaggtgctgaccgcgggt
tcgggccagaacccggcgcgccaggcgttgatcaaggccggcctgcccgacatggtgccg
ggcatgaccatcaacaaggtgtgcggctcgggcctgaaggccgtgatgctggctgccaac
gccatcgtcgccggggaggccgacatcgtcgtggccggcgggcaggagaacatgtccgcc
gcgccgcacgtgctgcccggctcgcgcgacggcttccgcatgggcgacaccaagctcatc
gactcgatgatcgtggatgggctttgggacgtctacaaccagtaccacatgggcatcacc
gccgagaacgtcgccaagcagtacggcatcacgcgcgaggcccaggacgcattcgccgtg
gcctcgcagaacaaggcggaagccgcgcagaagtccggccgtttcaatgacgagatcgtt
cccatcctgattccgcagcgcaagggtgacccgatcgccttcgcgcaggacgagttcgtc
cgtcatggcgccacgctggaatcgatgacgggcctgaagccggcattcgacaaagccggc
acggtgacggccgccaatgcctcgggcctcaacgacggcggcgccgccgtggtggtcatg
tcggccgccagtgccaaggaactgggtctgaccccgctggccaccattcgtgcctacgcc
aatgccggcgtggacccgaaggtgatgggcatgggcccggtgccggcctccaagcgctgc
ctgtcgcgcgccggctggtcggtgggcgacctggacctgatggagatcaacgaggcgttt
gccgcccaggcgctggccgtgcaccagcagatgggctgggataccgccaaggtcaacgtc
aacggcggcgcgatcgccatcggtcaccccatcggcgcgtcgggctgccgcatcctggtg
acgctgctgcacgagatgcagaagcgcgatgcgaagaagggcctggcctcgctgtgcatc
ggcggcggcatgggcgtggcgctggcggtcgagcgcccgtga

DBGET integrated database retrieval system