KEGG   Ralstonia solanacearum CMR15: CMR15_20521Help
Entry
CMR15_20521       CDS       T02725                                 

Gene name
pit
Definition
(GenBank) phosphate transporter, low-affinity
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rsm  Ralstonia solanacearum CMR15
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CMR15_20521 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 FGGY_C
Motif
Other DBs
NCBI-ProteinID: CBJ38564
UniProt: D8N4R2
Position
2471923..2472933
Genome map
AA seq 336 aa AA seqDB search
MHTLQISLWVVVLLVALAILFDFMNGFHDAANSIATVVSTGVLKPQQAVAMAAACNVIAI
FIFHLKVATTVGRDTIDPSIVDHYVIFGALVGAIAWNIITWYYGIPSSSSHALIGGLVGA
AVAKSGTGSLVASGLLKTVAFILISPLLGFILGSCLMIAVSWLFFRTPPSKVDRWFRRLQ
LLSASLYSLGHGGNDAQKTIGIIWMLLIAGGYASATASTPPIWVIVCCYVAIGMGTLLGG
WRIVRTMGQKITKLKPVGGFCAETGGALTLFLASALGVPVSTTHTITGAIVGVGAAQKAS
AVRWGVAGNIVWAWGLTIPASAFMAAIAWWIGRQLL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcacacactccagatcagtctttgggtggtcgtcctgctggtggcactggccatcctg
ttcgatttcatgaacggcttccacgatgcggccaactccattgccacggtggtatcgacc
ggcgtgctcaagccgcagcaggcggtggcgatggctgcggcctgcaacgtgatcgccatt
ttcatctttcacctcaaggtcgcgacgacggtggggcgcgacaccatcgacccgagcatc
gtcgatcactacgtcatcttcggcgccctggtgggggcgatcgcctggaacatcatcacc
tggtattacggcattccgtcgagctcctcgcatgcgttgatcggcgggctggtgggggcg
gccgtggccaagtcgggcacgggctcgctggtggccagcggtctgctgaagacggtggcg
ttcatcctgatttcgccgttgctggggttcatcctcggctcgtgcctgatgattgcggtg
tcctggctgttcttccgaacgccgccttccaaggtggatcgctggttccggcggctgcaa
ctgctgtcggcgtcgctgtacagcctgggccacggcggcaacgatgcgcagaagaccatc
ggcatcatctggatgctgctgatcgccggcggttatgcctcggccacggcgagcacgccg
ccgatctgggtgatcgtgtgctgctacgtggcaatcggcatgggcacgctgctgggcggc
tggcgcatcgtccggaccatggggcagaagatcaccaagctcaagccggtgggcggtttc
tgcgctgaaaccggtggcgcgctgacgctgttccttgcttcggcgctgggcgtgccggtt
tcgaccacgcataccatcaccggtgccattgtcggcgtgggcgcggcgcagaaggcttcg
gccgtgcgttggggcgttgccggcaatatcgtctgggcgtggggtctgacgattccggcg
tcggccttcatggcggcgatcgcctggtggatcgggcggcagctgctctga

DBGET integrated database retrieval system