KEGG   Ralstonia solanacearum CMR15: CMR15_20573Help
Entry
CMR15_20573       CDS       T02725                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
rsm00620  Pyruvate metabolism
rsm00630  Glyoxylate and dicarboxylate metabolism
rsm01100  Metabolic pathways
rsm01110  Biosynthesis of secondary metabolites
rsm01120  Microbial metabolism in diverse environments
rsm01200  Carbon metabolism
Module
rsm_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CMR15_20573 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    CMR15_20573 (aceB)
Enzymes [BR:rsm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CMR15_20573 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase FlpD
Motif
Other DBs
NCBI-ProteinID: CBJ38616
UniProt: D8N4W4
Position
2527705..2529294
Genome map
AA seq 529 aa AA seqDB search
MTTMELTLPQGMAIKAEILPAYEDILTPEALALVARLHRAFEPRRQQLLAARAERVKRLD
AGERPDFLPETRHIREGDWAIAPIPPALECRRVEITGPVDAKMVINAFNSGADSYMTDFE
DSNAPSWHNQIQGQVNLKAAIRRTLTLESGGKSYKLNDKIATLQVRPRGWHLDEKHVTVD
GQRVSGGIFDFALFFFHNAREQLARGAGPFFYLPKMESHLEARLWNDVFIAAQEALGLPQ
GTIKATVLIETILAAFEMDEILYELREHSAGLNAGRWDYIFSCIKKFKVDQNFCLADRAK
VTMTSPFMRAYALLLLKTCHKRNAPAMGGMSALIPIKNDPEKNAIAMQGIISDKKRDATD
GYDGGWVAHPGLVEAAMKEFVDVLGDAPNQIGKQRPDVNVAAADLLNFQPEQPITEAGLR
MNINVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLEDGTKVTAEL
VRKLIPEELAKVKADGAVGHFDRAAQIFEQMSTSESFSEFLTLPLYEEL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccatggagctgacgctgccccaaggcatggcgatcaaggccgagatcctgccg
gcctacgaagacatcctgacccccgaggccctggccctcgtcgccaggctgcaccgggcc
ttcgaaccgcgccgccagcagctgctggccgcccgcgccgagcgcgtcaagcgcctcgat
gccggcgagcgcccggacttcctgcccgagacccggcacatccgcgagggcgactgggcc
atcgccccgattccgcccgcgctggaatgccgccgcgtggagatcaccggcccggtcgac
gccaagatggtcatcaacgcgttcaattcgggcgcggacagctacatgaccgacttcgag
gattcgaatgccccgagctggcacaaccagatccagggccaggtcaacctcaaggccgcc
atccgccgcacgctcacgctggagtcgggcggcaagtcgtacaagctcaacgacaagatc
gccacgctgcaggtgcgcccgcgcggctggcacctcgacgagaagcacgtcacggtggac
ggccagcgcgtctcgggcggcatcttcgacttcgcgctgttcttcttccacaacgcgcgc
gagcagctcgcgcgcggcgccggcccgttcttctacctgccgaagatggagagccacctg
gaggcgcgcctgtggaacgacgtcttcatcgccgcgcaggaggcgctcggcctgccgcag
ggcaccatcaaggccaccgtgctgatcgagaccatcctcgccgcgttcgagatggacgag
atcctgtatgagctgcgcgagcacagcgccggcctgaacgcaggccgctgggactacatc
ttctcgtgcatcaagaagttcaaggtggaccagaacttctgcctggccgaccgcgccaag
gtcacgatgacctcgccgttcatgcgcgcctacgcgctgctgctgctcaagacctgccac
aagcgtaacgcgccggccatgggcggcatgagcgcgctgatcccgatcaagaacgatccg
gagaaaaacgccatcgccatgcagggcatcatcagcgacaagaagcgcgacgccaccgac
ggctacgacggcggctgggtggcgcacccgggcctggtcgaggcggccatgaaggaattc
gtcgacgtgctgggcgatgcccccaaccagatcggcaagcagcgccccgacgtgaacgtg
gccgccgccgacctgctgaacttccagcccgagcagcccatcaccgaggccggcctgcgc
atgaacatcaacgtcggcatccactacctgggtgcctggctggccggcaacggctgcgtg
ccgatccacaacctgatggaagacgcggccacggccgagatctcgcgctcgcaggtgtgg
cagtggatccgctcgcccaagggcacgctggaagatggcaccaaggtcacggccgagctg
gtgcgcaagctgatccccgaggaactggccaaggtgaaggcggacggtgcggtggggcac
ttcgatcgcgccgcgcagatcttcgagcagatgtccacgtcggaatcgttctcggaattc
ctgacgctgccgctgtacgaagaactctga

DBGET integrated database retrieval system