KEGG   Ralstonia solanacearum CMR15: CMR15_20692Help
Entry
CMR15_20692       CDS       T02725                                 

Gene name
bioF
Definition
(GenBank) 7-keto-8-aminopelargonic acid synthetase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
rsm00780  Biotin metabolism
rsm01100  Metabolic pathways
Module
rsm_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CMR15_20692 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rsm01007]
    CMR15_20692 (bioF)
Enzymes [BR:rsm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     CMR15_20692 (bioF)
Amino acid related enzymes [BR:rsm01007]
 Aminotransferase (transaminase)
  Class II
   CMR15_20692 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CBJ38732
UniProt: D8N5K8
Position
2660872..2662155
Genome map
AA seq 427 aa AA seqDB search
MRKPPARTKEKPMRLLDDLRAGLDAIDAAHLRRVRRTAYSPTDRSQRIDVPGGEPRDILG
FCGNDYLGLAAHPALMQAVGEGARRYGFGSGASHLVSGHSVAHARLEARMAALQAPHIPD
ADALFFCTGYMANMAVVSAMAPAGGIQPAQDCTVFSDTLNHASLIDGARLSRAAVKVYPH
VDLVALEAQLAACSSRNKLIVTDGVFSMDGDIAPLPELLALAERFDAWLIVDDAHGLGVL
GADGAGVLSHFDLCSERLIYIGTFGKAAGGAGACVVAHRMAIDWLVQRARTYIFTTATPP
AVACGVEAALDLIAGEEGAARRARLAGHIARWSDHAQRLAARFGWQWMPSPTAIQPLVIG
ENAPALALAAALEREGIRVAAIRPPTVPAGTARLRITLSAAHTEDDIERLARALEAAGSS
LQPACAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcaagccaccggcgcgcacgaaggagaaacccatgcgattgcttgacgacctgcgg
gccggcctggacgccatcgacgccgcgcacctgcgccgcgtacgccgcaccgcctacagc
cccaccgaccgcagccagcgcatcgacgtgccgggcggcgagccgcgcgacattctcggc
ttctgcggcaacgactacctcggcctggccgcgcatccggcgctgatgcaggcggtgggc
gagggcgcccgccggtacggcttcggcagcggcgcctcgcacctcgtcagcggccactcg
gtggcccatgcgcggctggaggcgcgtatggcggccctgcaggcgccgcatattcccgat
gccgatgcgctgttcttctgcaccggctacatggccaacatggcggtggtcagcgcgatg
gcgccggctggcggcatccagccggcgcaggactgcacggtcttctccgatacgctgaac
cacgcctcgctgatcgacggcgcccggctgtcgcgcgcggcggtcaaggtctatccgcac
gtcgacctggtcgcgctggaggcgcagctggccgcctgcagcagccgcaacaagctgatc
gtcaccgacggcgtgttcagcatggacggcgacatcgcgccgctgcccgaactgctggcg
ctggccgagcgcttcgatgcatggctgatcgtcgacgacgcgcacggtctgggcgtgctc
ggcgcggatggggcgggcgtgctgtcgcactttgatctgtgttccgagcgcctgatctat
atcggcaccttcggcaaggcggccggcggcgccggggcctgcgtggtggcgcaccggatg
gcgatcgactggctggtgcagcgggcccgcacgtatatcttcacgaccgccacgccgccc
gccgtcgcctgcggggtggaggcggcgttggacctgatcgccggggaggagggcgccgcg
cgccgggcccggctggccggccacatcgcccgctggagcgatcacgcgcagcggctggcg
gcacggttcggctggcagtggatgccgtctcccaccgcgatccagccgctggtgatcggc
gagaacgcgccggcgctggcgctggcggcggcgctggagcgcgagggcatccgcgtcgcc
gcgatccgcccgccgaccgtgccggccgggaccgcgcggctgcgcatcaccctgtccgcc
gcgcacaccgaggacgacatcgagcggctggcccgcgcgctggaagccgccggcagctcg
ctgcaacccgcctgcgccgcctga

DBGET integrated database retrieval system