KEGG   Ralstonia solanacearum CMR15: CMR15_30087Help
Entry
CMR15_30087       CDS       T02725                                 

Gene name
ltaA
Definition
(GenBank) Low Spcificity L-Threonine Aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
rsm00260  Glycine, serine and threonine metabolism
rsm01100  Metabolic pathways
rsm01110  Biosynthesis of secondary metabolites
rsm01120  Microbial metabolism in diverse environments
rsm01130  Biosynthesis of antibiotics
rsm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CMR15_30087 (ltaA)
Enzymes [BR:rsm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CMR15_30087 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CBJ38839
UniProt: D8N694
Position
complement(2748233..2749270)
Genome map
AA seq 345 aa AA seqDB search
MQHFASDNYAGFCPESLKYFLEANGSGHEPAYGDDSWTQRVCDRIRDLFETDCEVFFVFN
GTAANSLALSALCQSYHSVICHELAHIETDECGGPEFFSNGSKLLTAAGADGKLTPDAVE
ALVTRRSDIHYPKPKVVSLTQSTEVGTVYTVDEVRAIAAVAKRRQLRVHMDGARFANAVA
SLGVHPSEVTWRAGVDVLCFGGTKNGLPVGEAVVFFDRRLAEDFAYRVKQAGQLASKMRF
ISAPWLGLLENDVWLRNARHANAMAQLLHQRIREVPGVRILFPPQSNAVFAELPLPAIET
LHARGWRFYTFIGAGGCRFMCAWDLQPETVEALAGDIRLACEQAA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacttcgcctccgacaactacgccggcttctgcccggaatccctgaagtacttc
ctggaagcgaacggcagcggccacgagcccgcctacggcgacgattcctggacgcagcgc
gtatgcgaccgcatccgcgatctgttcgagaccgattgcgaagtctttttcgtcttcaac
ggcaccgccgccaattcgctggcgctgtcggcgctgtgccagtcgtaccactccgtcatc
tgccatgagctggcgcacatcgagacggacgagtgcggcggccccgagttcttctccaac
ggctccaagctgctgaccgccgcgggcgccgacggcaagctgacgcccgacgcggtggag
gcgctggtcacgcgccgctccgatatccactatccaaagcccaaggtggtctcgctcacg
cagtcgaccgaggtgggcacggtctacacggtggacgaggtgcgcgcgatcgccgccgtc
gccaagcgtcggcagttgcgcgtgcacatggatggcgcgcgcttcgccaacgcggtggcc
tcgctcggcgtgcatccgtccgaggtcacctggcgtgccggggtcgacgtgctgtgcttc
ggcggcaccaagaacggcctgccggtgggcgaggcggtggtgttcttcgaccgccgcctg
gccgaggacttcgcctaccgcgtcaagcaggccgggcaactggcctccaagatgcgcttc
atctccgcgccgtggctgggcctgctggagaacgacgtgtggttgcgcaacgcgcgccat
gccaatgcgatggcgcagctgctgcaccagcgcatccgcgaggtgccgggcgtgcgcatc
ctgttcccgccgcagtccaatgccgtgttcgccgagctgccgctgcccgccatcgagacg
ctgcacgcgcgcggttggcgcttctacaccttcatcggcgcgggcggttgccgcttcatg
tgcgcgtgggatctgcagcccgagacggtggaagcgctcgccggcgacatccgcctggcc
tgcgagcaggccgcatag

DBGET integrated database retrieval system