KEGG   Ralstonia solanacearum CMR15: CMR15_30660Help
Entry
CMR15_30660       CDS       T02725                                 

Gene name
argS
Definition
(GenBank) Arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
rsm00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CMR15_30660 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rsm01007]
    CMR15_30660 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rsm03016]
    CMR15_30660 (argS)
   03029 Mitochondrial biogenesis [BR:rsm03029]
    CMR15_30660 (argS)
Enzymes [BR:rsm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     CMR15_30660 (argS)
Amino acid related enzymes [BR:rsm01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   CMR15_30660 (argS)
Transfer RNA biogenesis [BR:rsm03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CMR15_30660 (argS)
 Prokaryotic Type
   Other AARSs
    CMR15_30660 (argS)
Mitochondrial biogenesis [BR:rsm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CMR15_30660 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1 YdfA_immunity
Motif
Other DBs
NCBI-ProteinID: CBJ39407
UniProt: D8N9F5
Position
3319269..3321071
Genome map
AA seq 600 aa AA seqDB search
MLPSHKQTISQLLSDAVGTLLPEGTNRPEIVLERPKQAAHGDIACNVALQLAKPLGTNPR
ELANRIADGIRADARGQRLVSAVEIAGPGFINLRLSPTARTDVLTAVFAEGDRYGAADLH
DGAPVLVEFVSANPTGPLHVGHGRQAALGDALAALLEWQGHKVHREFYYNDAGVQIHNLA
VSVQARARGFKPGDAGWPEAAYNGDYIADIAADYLAGKTVRASDGEPVTGARDVENMEAI
RRFAVTYLRNEQDIDLQAFGVKFDHYYLESSLYADGKVQQTVDALIAAGKTYEQEGALWL
RTTDDGDDKDRVMRKSDGSYTYFVPDVAYHTTKWGRGFTQVINVQGSDHHGTIARVRAGL
QGLDIGIPKGYPDYVLHKMVTVMKDGAEVKISKRAGSYVTVRDLIEWSNGDVESEAGVDT
IRACVDSGAPNWPGRFTRGRDAVRFFLLSRKADTEFVFDVDLALKQSDENPVYYVQYAHA
RICSVFEQWHAREGGDAASLAGADLAAVAGPEASPQAVALVQRIAAFPDVLADAARELAP
HAVAFYLRDLAGDFHAFYNADRVLVDDDAVKRARLALLAATRQVLRNGLAVIGVSAPQKM
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgctgccctcccacaaacagacgatctcccaactgctgtccgacgccgtcggcaccctg
ctgccggaaggcacgaaccgaccggaaatcgtcctggagcgccccaagcaggccgcgcac
ggcgacatcgcgtgcaacgtcgcgctgcagctggccaagccgctgggcaccaacccgcgc
gaactcgccaaccgcatcgccgacggcatccgcgccgatgcacgcggccagcggctcgtc
tcggcggtggaaatcgccggcccgggcttcatcaacctgcgcctgtcgcccaccgcccgc
accgatgtgctcaccgccgtgttcgccgagggcgaccgctacggtgccgccgacctccat
gacggcgcgccggtgctggtggagttcgtctcggccaacccgaccggtccgctgcacgtc
ggccacggccgccaggcggcgctgggcgatgcgctggccgccctgctggagtggcagggc
cacaaggtccaccgcgagttctactacaacgacgcgggcgtgcagatccacaacctggcc
gtctcggtgcaggcccgtgcgcgcggcttcaagccgggcgacgccggctggcccgaggcc
gcctacaacggcgactacatcgccgacatcgccgccgactacctcgccggcaagaccgta
cgcgcctccgacggcgagccggtgaccggcgcgcgcgacgtggagaacatggaggccatc
cgccgcttcgccgtcacgtacctgcgcaacgagcaggacatcgacctgcaggccttcggg
gtgaagttcgaccactactacctcgaatcgtcgctgtacgccgacggcaaggtgcagcag
accgtcgatgcgctgatcgccgccggcaagacctacgagcaggagggcgcgctgtggctg
cgcaccaccgacgacggcgacgacaaggaccgcgtgatgcgcaagtccgacggcagctac
acctacttcgtgccggacgtggcctaccacaccaccaagtgggggcgcggcttcacgcag
gtcatcaacgtgcagggcagcgaccaccacggcaccatcgcccgcgtgcgcgccggcctg
caaggcctggatatcggcatccccaagggctaccccgactacgtcctgcacaagatggtg
acggtgatgaaggacggcgccgaggtgaagatctccaagcgcgccggctcctacgtgacc
gtgcgcgacctgatcgaatggagcaacggcgacgtcgagtccgaagccggcgtcgacacc
atccgcgcctgcgtcgactcgggcgcgccgaactggcccggacgcttcacgcgcggccgc
gatgcggtgcgcttcttcctgctgtcgcgcaaggcggatacggaattcgtctttgacgtg
gacctggcgctcaagcagagcgacgagaacccggtgtactacgtgcaatatgcccacgcc
cggatctgctcggtgttcgagcagtggcatgcgcgcgagggcggcgacgcggcttcgctc
gccggggccgacctggccgccgtggcgggtccggaagccagcccgcaggccgtcgcgctg
gtccagcgcatcgccgccttcccggacgtgctggccgacgccgcccgcgagctggcgccg
cacgccgtcgccttctacctgcgggacctggcgggcgacttccacgccttctacaacgcc
gaccgcgtgctggtggacgatgacgccgtcaagcgtgcccgcctggcgctgctggcggcc
acgcgccaggtgctgcgcaacggcctggcggtgatcggtgtctcggcaccgcaaaagatg
tga

DBGET integrated database retrieval system