KEGG   Ralstonia solanacearum CMR15: CMR15_mp10667Help
Entry
CMR15_mp10667     CDS       T02725                                 

Definition
(GenBank) putative isopenicillin N epimerase protein (class v)
  KO
K04127  isopenicillin-N epimerase [EC:5.1.1.17]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
rsm01100  Metabolic pathways
rsm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    CMR15_mp10667
Enzymes [BR:rsm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.17  isopenicillin-N epimerase
     CMR15_mp10667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: CBJ40316
UniProt: D8NHE2
Position
CMR15_mp:776506..777771
Genome map
AA seq 421 aa AA seqDB search
MHSKWEFKDSPKAFRSRFLLDPSVTCLNHGMLGACPSEVLEQQNALRARIERQPAAFILR
DLTGLLDEARQALAGLVSADPADLALLPNVTTALSAVLRSRAFAPGDEILTTNHAYLACT
NLLDFVARETGARVVTAMVPTPVTHADAVVDAVLERVTPRTRLAVLDHVTSPTGMVFPIA
ALVERLAARGVDTLVDGAHAPGMLPLDVQAIGAAYYAGNCHKWLCSPRGAGFLHVRRDRH
EGLHPTVISRGYGATGTGRPRLHLEFDWLGTADPTPLLCIPHAIRFLDGLLPGGLPELMA
RNRALVIEGAQRMAEGLPLKRLAPDSMVGSMVAFQLPETPEPAWVSADGAASLQRWLYDA
HRIDVAAAAWPAARSRVLRVSAQIYNAIDDFIRLGDVLRRAPEHLQDTSAATRSTAWSDV
T
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgcattccaagtgggaattcaaagacagtcccaaggcgttccgaagccgcttcctgctc
gatccgagcgtgacgtgcctcaaccacggcatgctgggcgcctgtccgtccgaggtgctc
gagcagcagaacgcgctgcgcgcgcgcatcgagcgccagcccgctgcgttcatcctgcgc
gatctcacgggcctgctcgacgaggcgcggcaggcgctggccgggttggtctcggccgat
ccggcggatctggccctgctgcccaacgtcacgacggcactgagcgcggtgctgcgttcg
cgtgcgttcgcgccgggcgatgaaatcctcacgaccaatcacgcctaccttgcgtgcacg
aacctgctcgatttcgtggcgcgcgagaccggcgctcgggtggtgacggcgatggtgccg
acgcccgtgacgcacgcagacgcggtcgtcgatgccgtgctcgaacgcgtcacgccgcgc
acgcggctggccgtgctcgaccacgtcaccagccccaccgggatggtcttcccgatcgcc
gcgctggtcgaacggctcgcggccaggggcgtcgatacgctcgtcgacggggcgcacgcg
ccggggatgctgccgctcgacgtgcaagccatcggcgccgcgtactacgcgggcaactgc
cacaaatggctctgcagcccgcggggcgccggcttcctccatgtgcggcgcgaccgccac
gaaggtctgcacccgacggtcatcagccgcggctacggcgccacgggcacgggccggccc
cgtctgcatctcgagttcgactggctcggcacggccgatccgacgccgctgctctgcatt
ccgcatgcgatccgcttcctcgacgggctgctgcccggcggcctgccggagctcatggcg
cgcaaccgagccctcgtgatcgaaggcgcgcagcgcatggcggagggcttgccgctcaag
cggctggcgcccgattcgatggtgggcagcatggtggccttccagcttcccgagacaccg
gagccggcgtgggtatcggccgatggcgcggcatcgctgcagcggtggctgtacgacgcg
catcggatcgacgtcgctgccgccgcgtggccggccgcgcgcagccgcgtgctccgggta
tcggcacagatctacaacgcgatcgacgatttcatccgacttggcgacgtgctgcggcgc
gcgcccgaacacttgcaagacacgagcgcggcaacgcgttccaccgcctggagcgacgta
acatga

DBGET integrated database retrieval system