KEGG   Ralstonia solanacearum CMR15: CMR15_mp10803Help
Entry
CMR15_mp10803     CDS       T02725                                 

Gene name
aldH
Definition
(GenBank) NADP-dependent fatty aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
rsm00040  Pentose and glucuronate interconversions
rsm00053  Ascorbate and aldarate metabolism
rsm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CMR15_mp10803 (aldH)
   00053 Ascorbate and aldarate metabolism
    CMR15_mp10803 (aldH)
Enzymes [BR:rsm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     CMR15_mp10803 (aldH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CBJ40450
UniProt: D8NHS6
Position
CMR15_mp:935263..936849
Genome map
AA seq 528 aa AA seqDB search
MYLSGELLLGAARVAGGAGTVRAMNPATGEWLEPQFTLASRADVARACELAGAAFDVYRE
TAPEARAAFLEAIASQIEALGEVLIERAMAESALPRPRLEGERGRACNQLRLFAKVVRAG
DAVGARIDPALPERKPLPRSDLRMRRIAVGPVAVFGASNFPLAFSVAGGDTASALAAGCP
VVVKAHPAHPGTSELVGRAIQAAVAQCGLPEGVFSLVLADNEAAGALVADPRIQAVGFTG
SRAGGQALLRIAQARPQPIPVYGELSAINPVFLLPDALARRAAALGQQYVGSLTMGAGQF
CTNPGLLLAIDGPDLDAFEAAAAEALQASAAQTMLTSGIHAAYSRGVERLAGEANVRCVA
RGQGSDAPNRGQAGFFRTDAESFRAQPALHDEIFGATGLVVRCRDAEELKALAESLEGQL
TATLHLDAGDTALARALLPILERKAGRILANGWPTGVEVCHAMVHGGPWPATTDTRTTSV
GTAAIERFLRPVCYQDLPAELLPAALHDDNPQQLRRLVDGAWTAPRER
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtatctgagcggcgaactgctgctgggtgccgcccgcgtggcgggcggcgccggaact
gtccgcgccatgaacccggccacgggcgaatggctcgaaccccaattcaccctggccagc
cgggccgacgttgcccgcgcctgcgaactcgccggcgcggcgttcgacgtttaccgcgag
accgcgcccgaagcgcgcgccgcgttcctggaggccatcgccagccagatcgaggcgctg
ggcgaggtgctgatcgagcgcgccatggcggaatccgcgctgccgcgcccgcgcctggaa
ggcgagcgtggtcgcgcctgtaaccagctgcgcctgtttgccaaggtggtgcgcgcgggc
gatgccgtcggcgcgcgcatcgatccggcgttgccggagcgcaagccgctgccgcgttcg
gacctgcgcatgcgccgcattgccgtggggccggtggccgtgttcggcgccagcaatttc
ccgctggccttctcggtggcgggcggcgatacggcgtcggcactggcggcgggctgcccg
gtggtggtgaaggcgcatccggcgcaccccggcacgtccgaactggtcggtcgcgccatc
caggccgccgtggcgcagtgcgggctgccggaaggcgtgttctcgctggtgctggccgac
aacgaggccgccggcgcgctggtggccgatccgcgcattcaggcggtcggcttcaccggc
tcgcgcgcgggcgggcaggcgctgctgcgcatcgcgcaggcgcgtccgcagccgattccc
gtgtacggcgagctgagcgccatcaacccggtcttcctgctgccggacgcgctggccagg
cgggcggcggcgctgggtcagcagtacgtcggctcgctcaccatgggcgcgggacagttc
tgcaccaacccgggcctgctgctggccatcgacgggccggacctcgacgccttcgaggcc
gccgccgccgaggccctgcaggccagcgccgcgcagaccatgctgacctccggcatccac
gccgcgtatagccgaggcgtcgaacgcctggccggcgaggccaacgtgcgctgcgtggcg
cgcgggcagggcagcgatgcacccaaccgcggccaggccggcttcttccgcaccgatgcc
gagagcttccgggcccagccggcgctgcatgacgagatcttcggcgccaccggcctggtc
gtgcgctgccgcgatgccgaggaactgaaggcgctggccgagtcgctcgaaggccagctg
accgccacgctgcacctggatgcgggcgacacggcactggcccgcgcgctgctgccgatc
ctggagcgcaaggccggccgcatcctcgccaacggctggccgaccggcgtggaggtctgc
catgccatggtgcacggcggcccctggccggcgaccacggacacccgcacgacctcggtc
ggcacggcggccatcgagcgcttcctgcgcccggtgtgctaccaggatttgcccgccgaa
ctgctgccggccgccctgcacgacgacaatccgcagcagttgcggcggctggtcgacggc
gcctggaccgcgccgcgcgagcgctga

DBGET integrated database retrieval system