KEGG   Ralstonia solanacearum CMR15: CMR15_mp20221Help
Entry
CMR15_mp20221     CDS       T02725                                 

Gene name
ltaA
Definition
(GenBank) low specificity L-threonine aldolase protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
rsm00260  Glycine, serine and threonine metabolism
rsm01100  Metabolic pathways
rsm01110  Biosynthesis of secondary metabolites
rsm01120  Microbial metabolism in diverse environments
rsm01130  Biosynthesis of antibiotics
rsm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CMR15_mp20221 (ltaA)
Enzymes [BR:rsm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CMR15_mp20221 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CBJ40795
UniProt: D8NE11
Position
CMR15_mp:1358431..1359528
Genome map
AA seq 365 aa AA seqDB search
MNRDPMPTTRTPALGFTSDNIEGASPEVLDAILAANSGQAAPYGADDCTARVEQTLSELF
EREVKVFLVPTGTAANALCLGAMTPPWGNVYCHPSSHINNDECGAPEFYTNGAKLVAVDG
PSAKIDVEKLRAATRIKVGDVHSTQPACISLTQATEVGSLYTLNEIEAIGQLCKDARIKL
HMDGSRFANALVSLGCSPAAMTWKAGVDALSFGATKNGVVAAEAIVLFDLSLAAEMGYRR
KRAGHLFSKMRFLSAQIEAYLANDLWLRNARQANDMALRLARGLEGLHGVSVLGATEANI
VFCRLPSVVTESLLRAGFRFYHDRWAPNVVRFVTSFATTADDVDNLLRHVRAAAIGASSS
THATA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgcgatccgatgccgaccacccgaacccccgccctgggctttaccagcgacaac
atcgaaggcgcttcgcccgaggtgctcgacgccatccttgccgccaattccggtcaggcg
gccccgtacggcgcggacgactgcaccgcccgggtcgagcaaacgctgagcgagctgttc
gagcgcgaagtcaaagtcttcctggtcccgaccggcaccgcggccaacgcgctctgcctg
ggcgcgatgacgccgccctggggcaacgtgtactgccacccgtcgagccatatcaacaac
gacgagtgcggtgcccccgagttctatacgaacggtgcgaagctggtcgcagtggatggg
ccatccgccaagatcgatgtggagaagcttcgcgccgccacccgcatcaaggtgggcgac
gtgcattccacccaacccgcttgcatcagcctgacgcaagcgacggaagtggggagcctc
tacacgctgaacgagatcgaagcgatcggacagctctgcaaggacgcccgcatcaagctg
catatggatggctcgcgctttgccaacgcgctggtctccctgggctgctcgcccgcggcc
atgacgtggaaggcgggtgtcgatgcgttgtcgttcggcgcaaccaagaatggcgtcgtc
gcagcggaagccattgtgctgtttgacctgtcactcgcggccgagatgggctaccgccgc
aagcgggccggccatctgttctcgaagatgcgttttctgtcggcccagatcgaagcctac
ctggccaacgatctctggctgcgcaacgcacgccaggcgaacgacatggccctgcgcctg
gcccgtggcctggaagggctgcatggcgtcagcgtgcttggtgccacggaggccaatatc
gttttctgccgccttccctcagtcgtcactgaaagcctgcttcgggcgggattccgcttt
tatcacgatcgctgggcgccgaacgtggtgcgctttgtgacgtccttcgctaccacggct
gatgatgttgacaacctgctgcggcatgtgagggctgcggccatcggggcatcgtcgagc
acgcatgccactgcatga

DBGET integrated database retrieval system