KEGG   Ralstonia solanacearum CMR15: CMR15_mp20252Help
Entry
CMR15_mp20252     CDS       T02725                                 

Gene name
glsA
Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
rsm00220  Arginine biosynthesis
rsm00250  Alanine, aspartate and glutamate metabolism
rsm00471  D-Glutamine and D-glutamate metabolism
rsm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CMR15_mp20252 (glsA)
   00220 Arginine biosynthesis
    CMR15_mp20252 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CMR15_mp20252 (glsA)
Enzymes [BR:rsm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CMR15_mp20252 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: CBJ40825
UniProt: D8NE41
Position
CMR15_mp:1390870..1391784
Genome map
AA seq 304 aa AA seqDB search
MDYQAILETIHRDIQPWLGKGRVADYIPELAKASATDFGMAIVTPRGEVFGVGQAETLFS
IQSISKLFACTLAFQLEGESLWQRVGREPSGNAFNSLVQLEHENGIPRNPFINAGALVVT
DVLCRRFVQAETAMVQFMRRLVDNPRVDYNPRVALSELEHADRNRAMAHFMRSFGNLHMP
VETVIDAYCRQCAIEMNCVDLARAVLFLANGGVVPWSGERVIEASPAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEFGVCVWSPGLDVSGNSLAGLQALEWLTTLSG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggactaccaagcgatcctggaaaccatccaccgcgacatccagccctggctcggcaag
ggccgcgtggccgactacattcccgagctggccaaggccagcgccaccgatttcggcatg
gcgatcgtcaccccgcgcggcgaggtgttcggcgtcgggcaggccgagacgctgttctcc
atccagagcatttccaagctgtttgcgtgcacccttgccttccagctggaaggcgaatcg
ctgtggcagcgggtcggccgcgagccgtccggcaacgccttcaactcgctggtgcagctg
gagcacgaaaacggcatcccgcgcaatccgttcatcaacgccggcgcgctggtggtgacg
gacgtgctgtgccggcgcttcgtgcaggccgagacggccatggtgcagttcatgcggcgg
ctggtcgacaacccgcgcgtcgactacaacccgcgcgtggcgctgtccgaactcgaacac
gcggaccgcaaccgcgccatggcgcacttcatgcgcagcttcggcaacctgcacatgccg
gtcgaaacggtgatcgacgcctactgccggcagtgcgccatcgagatgaactgcgtggac
ctcgcccgcgccgtgctgttcctggccaacggcggcgtggtgccgtggagcggcgagcgc
gtgatcgaggccagtccggccaagcgcctgtccgcgctgatgctgacttgcggcacctac
gacgcggccggcgatttcgtctaccgggtcggcctgccggccaagagcggcgtgggcggc
ggcatcgtcgcggtgctgccgggcgagttcggcgtgtgcgtgtggtcgccggggctggac
gtgagcggcaactcgctggccggcctgcaggcgctggagtggctgacgacgctcagcggc
cggtcgatcttctga

DBGET integrated database retrieval system