KEGG   Ralstonia solanacearum Po82: RSPO_c00351Help
Entry
RSPO_c00351       CDS       T02005                                 

Definition
(GenBank) propanol-preferring alcohol dehydrogenase protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00010  Glycolysis / Gluconeogenesis
rsn00071  Fatty acid degradation
rsn00350  Tyrosine metabolism
rsn00625  Chloroalkane and chloroalkene degradation
rsn00626  Naphthalene degradation
rsn01100  Metabolic pathways
rsn01110  Biosynthesis of secondary metabolites
rsn01120  Microbial metabolism in diverse environments
rsn01130  Biosynthesis of antibiotics
rsn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSPO_c00351
  Lipid metabolism
   00071 Fatty acid degradation
    RSPO_c00351
  Amino acid metabolism
   00350 Tyrosine metabolism
    RSPO_c00351
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RSPO_c00351
   00626 Naphthalene degradation
    RSPO_c00351
Enzymes [BR:rsn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RSPO_c00351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C adh_short 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AEG67655
UniProt: F6G6W0
Position
complement(365843..366868)
Genome map
AA seq 341 aa AA seqDB search
MARSMKAAVVHAFGEPLRIEEVPIPTPGRGQILVNIRASGVCHTDLHAADGDWPVKPRLP
FIPGHEGVGFVAAVGEGVTAVKEGDRVGVPWLYTACGHCEHCLSGWETLCHDQQNTGYSV
NGGYAEYVLADPNYVGHLPAQVGFEEIAPILCAGVTVYKGIRMTDTRPGQWIAISGIGGL
GHVAVQYAVAMGLHVVAVDVAPEKLALARELGARLTVDASQQDPAAVIQKEVGGVHGVLV
TAVSRSAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
QFAAEGQVRAHIHRDRLDNINQVLADLKAGKVDGRIVLSLD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggccaggtcaatgaaagccgctgtcgtgcacgcgttcggcgaaccgctgcgcatcgag
gaagtccccatcccgacaccgggccgcgggcagatcctcgtcaacatccgggcctccgga
gtctgccacaccgacctgcacgccgccgatggcgactggccggtcaagccgcgcctgccg
ttcatcccgggacacgagggcgtggggttcgtggcggcggtgggcgaaggcgtcaccgcc
gtcaaggaaggcgaccgcgtgggcgtgccctggctctacaccgcctgcggccactgcgag
cattgcctcagcggctgggaaaccctgtgccacgaccagcagaacaccggctactccgtc
aacggcggctatgccgaatacgtgctggccgacccgaactatgtcggccacctgcccgcg
caggtcggcttcgaggagatcgcgcccatcctgtgcgcgggcgtgacggtctacaagggc
atccgcatgaccgacacccggcccggccagtggatcgccatctcgggcatcggcgggctg
gggcatgtggcggtgcagtacgctgtcgccatggggctgcacgtggtggcggtggatgtc
gcccccgagaagctggcgctggcgcgcgagctgggcgccaggctgaccgtcgatgcctcg
cagcaagacccggccgccgtcatccagaaggaggtgggcggcgtgcacggtgtactggtg
acggcggtctcgcgcagcgcctttgcccaggccctgggcatggtgcggcgcggcggcact
gtctcgctcaacgggctgccgccgggcgactttccgctaccgatcttctcaacggtgctc
aacggcatcacggtgcgcggctccatcgtcggcacgcggcgcgacctgcaggaatcgctg
cagtttgccgccgaggggcaggtgcgcgctcacatccaccgcgaccggctcgacaacatc
aaccaggtcctcgccgacctgaaggccggcaaggtggacggccgcatcgtcctctcgctg
gattga

DBGET integrated database retrieval system