KEGG   Ralstonia solanacearum Po82: RSPO_c00482Help
Entry
RSPO_c00482       CDS       T02005                                 

Gene name
rplV
Definition
(GenBank) 50s ribosomal protein l22
  KO
K02890  large subunit ribosomal protein L22
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rsn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RSPO_c00482 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rsn03011]
    RSPO_c00482 (rplV)
Ribosome [BR:rsn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    RSPO_c00482 (rplV)
  Bacteria
    RSPO_c00482 (rplV)
  Archaea
    RSPO_c00482 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AEG67785
UniProt: F6FXQ2
Position
514676..515005
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPIERALNVLTFSPKKAAGIVKKVVESAIANAEH
NEGADIDELKVKSIYIDKATSLKRFTARAKGRGNRIEKQTCHITVTLGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagttaaagcgattcatcgcggcgcccgtatctccgcacagaagacgcgtctggtt
gccgaccagatccgtggtctgccgatcgagcgtgcactcaacgttctgacgttcagcccg
aagaaggcggctggcatcgtgaagaaggtggttgagtccgccatcgcgaatgcggagcac
aacgaaggtgccgacatcgacgagctgaaggtcaagtcgatctacatcgacaaggctacc
tcgctcaagcgcttcaccgcgcgtgcgaagggccgtggcaaccgcatcgagaaacaaacc
tgtcacatcactgtgacgctgggcaactaa

DBGET integrated database retrieval system