KEGG   Ralstonia solanacearum Po82: RSPO_c00630Help
Entry
RSPO_c00630       CDS       T02005                                 

Gene name
apaG
Definition
(GenBank) ApaG
  KO
K06195  ApaG protein
Organism
rsn  Ralstonia solanacearum Po82
Brite
KEGG Orthology (KO) [BR:rsn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    RSPO_c00630 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AEG67932
UniProt: F6FYC8
Position
647223..647597
Genome map
AA seq 124 aa AA seqDB search
MSRYELTVQVRTRYLPEQSEPSQGQYAFAYTITIRNTGEVPSQLISRHWIITDAESHVQE
VAGLGVVGHQPLLPPGESFEYTSWATIKTPVGTMRGEYFCVADDGHRFEAPIPEFALAMP
RMLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgctacgaactcaccgtccaggtccggacgcgctacctgcccgagcaatccgag
ccctcgcagggccagtacgccttcgcctacaccatcaccatccgcaataccggcgaggtg
ccgagccaactgatctcgcggcactggatcatcaccgatgcggagagccacgtgcaggag
gtcgccggcctcggcgtggtcggccaccagccgctgctgccgccgggcgagtcgttcgaa
tacaccagttgggcgaccatcaagacgccggtgggcaccatgcgcggcgaatatttctgc
gtggccgacgacggccaccgcttcgaggcgccgatccccgagttcgcgctggcgatgccg
cgcatgctgcactga

DBGET integrated database retrieval system