KEGG   Ralstonia solanacearum Po82: RSPO_c01555Help
Entry
RSPO_c01555       CDS       T02005                                 

Definition
(GenBank) propanol-preferring alcohol dehydrogenase protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00010  Glycolysis / Gluconeogenesis
rsn00071  Fatty acid degradation
rsn00350  Tyrosine metabolism
rsn00625  Chloroalkane and chloroalkene degradation
rsn00626  Naphthalene degradation
rsn01100  Metabolic pathways
rsn01110  Biosynthesis of secondary metabolites
rsn01120  Microbial metabolism in diverse environments
rsn01130  Biosynthesis of antibiotics
rsn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSPO_c01555
  Lipid metabolism
   00071 Fatty acid degradation
    RSPO_c01555
  Amino acid metabolism
   00350 Tyrosine metabolism
    RSPO_c01555
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RSPO_c01555
   00626 Naphthalene degradation
    RSPO_c01555
Enzymes [BR:rsn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RSPO_c01555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AEG68855
UniProt: F6G0K9
Position
complement(1620905..1621921)
Genome map
AA seq 338 aa AA seqDB search
MPASMQAMICSRAGAPLQLQTVPLPEPGPGEVRLAVSVCGVCRTDLHIVDGELPAPKPAL
IPGHEIVGTVNASGPGVDGLARGDRVGVPWLGWTCGACPFCLRDQENLCDRPRFTGYTRD
GGYAEYTVCDARYCLPIPARYDDAHAAPLLCAGLIGYRTLRMAGDARRLGIYGFGAAAHL
VTQIAAAEHREVFAFTRAGDVDTQRLARDTGACWAGASEQAPPVPLDAALIFAPVGALVP
VALRAVVKGGSVVCGGIHMSDIPAFPYRLLWEERKLMSVANLTRADGLALMRVAAMVPLQ
SRITLYPLAEANTALDDLRAGRVVGAAVLQIRGAIDSR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctccatgcaagccatgatctgctcgcgcgccggtgcgccgctgcagttgcag
accgtgccgctgcccgaacccggccccggtgaagtccggctagcggtatcggtgtgcggc
gtatgccggacggatctgcatatcgtcgatggcgagttacccgccccgaagccggcgctg
atccctgggcacgagatcgtcggcaccgtcaatgcgagcggccccggcgtcgacgggctc
gcacgcggcgaccgcgtcggcgtaccctggctggggtggacctgcggtgcctgcccgttc
tgcctgcgcgaccaggaaaacctgtgcgaccggccccgcttcacgggctacacgcgcgac
ggcggctacgccgaatacaccgtttgcgatgcccgctactgcctgcccatcccggcacgc
tacgacgatgcccacgcggcgccactgctgtgcgcggggctgatcggctaccgcaccttg
cgcatggcgggcgacgcacggcgcctgggcatctacggctttggcgcggcggcccacctg
gtgacgcagatcgccgcggccgagcaccgcgaagtcttcgccttcacccgggcgggggat
gtcgacacgcagcggctcgcgcgcgacaccggcgcctgctgggcgggcgcaagcgagcag
gcaccgcctgtgccactcgatgccgcattgattttcgccccggtgggggcgctggttccc
gttgcgctgcgggccgtcgtcaagggcggctcggtggtctgcggcggcatccacatgagc
gacattccggccttcccctaccggctgctctgggaagaacgcaagctgatgtccgtagcg
aacctgacgcgcgccgacggcctggcgctgatgcgcgtggcagcaatggtgccgctgcaa
tcgcgtatcacgctctacccgcttgccgaggccaataccgcgctcgacgacttgcgcgcg
gggcgggtggtcggcgcggccgtgctgcagatccgcggcgcgatcgacagccgttga

DBGET integrated database retrieval system