KEGG   Ralstonia solanacearum Po82: RSPO_c01719Help
Entry
RSPO_c01719       CDS       T02005                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00071  Fatty acid degradation
rsn00072  Synthesis and degradation of ketone bodies
rsn00280  Valine, leucine and isoleucine degradation
rsn00310  Lysine degradation
rsn00362  Benzoate degradation
rsn00380  Tryptophan metabolism
rsn00620  Pyruvate metabolism
rsn00630  Glyoxylate and dicarboxylate metabolism
rsn00640  Propanoate metabolism
rsn00650  Butanoate metabolism
rsn00900  Terpenoid backbone biosynthesis
rsn01100  Metabolic pathways
rsn01110  Biosynthesis of secondary metabolites
rsn01120  Microbial metabolism in diverse environments
rsn01130  Biosynthesis of antibiotics
rsn01200  Carbon metabolism
rsn01212  Fatty acid metabolism
rsn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RSPO_c01719
   00630 Glyoxylate and dicarboxylate metabolism
    RSPO_c01719
   00640 Propanoate metabolism
    RSPO_c01719
   00650 Butanoate metabolism
    RSPO_c01719
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RSPO_c01719
   00072 Synthesis and degradation of ketone bodies
    RSPO_c01719
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSPO_c01719
   00310 Lysine degradation
    RSPO_c01719
   00380 Tryptophan metabolism
    RSPO_c01719
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RSPO_c01719
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RSPO_c01719
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RSPO_c01719
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsn04147]
    RSPO_c01719
Enzymes [BR:rsn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RSPO_c01719
Exosome [BR:rsn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RSPO_c01719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Alk_phosphatase ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AEG69019
UniProt: F6G0V1
Position
1789204..1790406
Genome map
AA seq 400 aa AA seqDB search
MALEAAMAREVVVVSGVRTAVGTFGGSLKDVAPCELGALVVREALARAQVRGEEVGHVVF
GHVINTEPRDMYLSRVAELNGGVPAETPAFNVNRLCGSGLQAVVSAAQTILLGDADVAIG
GGAESMSRAPYLAPAARWGSRMGDAKMIDMMLGALHDPFHAIHMGVTAENVAREYGISRE
LQDRTALESHQRASHAIRAGYFKDQIVPVTIPSRKGDVRFDTDEHVRHDATLDDMTRLKP
VFAAENGTVTAGNASGLNDAAAALVLMERSLAAQRGLKPLARLVSYGHAGVDPKVMGIGP
VPATRKALARAGLTVKDLDVVEANEAFAAQACAVTQQLGLDPARVNPNGSGISLGHPIGA
TGALITVKALYELQRIGGRYALVTMCIGGGQGIAAVFERL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggctctggaggcagcaatggcacgtgaagtggtggtggtcagcggtgtgcgcaccgca
gtcgggacgttcggcggcagcctgaaggacgtggcgccgtgcgagctgggtgcgttggtg
gtgcgcgaggcgctggcgcgcgcgcaggtccggggcgaggaggtcggtcacgtggtgttc
ggccacgtcatcaacaccgagccgcgcgacatgtacctgtcgcgcgtggctgagctgaac
ggcggcgtgccggccgaaacgcccgcgttcaacgtcaaccgcctgtgcggctccggcctg
caggccgtggtgagcgccgcgcagaccatcctgctgggtgatgccgacgtcgccatcggc
ggcggcgccgagagcatgagccgcgcgccgtacctggcgcccgcggcccgctggggttcg
cgcatgggcgacgccaagatgatcgacatgatgctcggcgcgctgcacgacccgttccac
gccatccacatgggcgtgacggcggaaaacgtcgccagggaatacggcatcagccgcgag
ctgcaggaccggaccgcgctggaatcgcaccagcgcgcgtcgcacgctatccgggccggc
tacttcaaggaccagatcgtcccggtgacgatcccgtcgcgcaagggcgacgtgcggttc
gataccgacgaacacgtccgccatgacgcgaccctcgacgacatgaccaggctcaagccg
gtcttcgcggcggaaaacggcacggtgacggcgggcaacgcctcgggcctgaacgatgcg
gcggcggccctggtgctgatggagcgctcgctggccgcgcagcgcggcctgaagccgctg
gcgcggctggtgtcgtacggccatgcgggcgtggacccgaaggtgatgggcatcggcccg
gtgccggcaacgcgcaaggcgctggcgcgcgccggcctgacggtcaaggacctggacgtg
gtcgaggccaacgaggccttcgctgcgcaggcctgcgcggtgacgcagcaactgggcctg
gacccggccagggtcaacccgaacggctcgggcatctcgctcggccacccgatcggcgcg
accggtgccctgattacggtgaaggcgctgtacgagctgcagcgcatcggtggtcgctac
gcgctggtgaccatgtgcattggtggaggacaaggcattgccgcggtgttcgaacgtctc
tga

DBGET integrated database retrieval system