KEGG   Ralstonia solanacearum Po82: RSPO_c01943Help
Entry
RSPO_c01943       CDS       T02005                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-d-xylulose 5-phosphate reductoisomerase protein
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00900  Terpenoid backbone biosynthesis
rsn01100  Metabolic pathways
rsn01110  Biosynthesis of secondary metabolites
rsn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RSPO_c01943 (dxr)
Enzymes [BR:rsn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     RSPO_c01943 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C GFO_IDH_MocA NmrA Semialdhyde_dh PAS
Motif
Other DBs
NCBI-ProteinID: AEG69242
UniProt: F6G1V9
Position
complement(2022898..2024079)
Genome map
AA seq 393 aa AA seqDB search
MMRITVLGATGSIGDSTLDVVRRHPDRYRVFALTANAQVDKLAALCRDFHPAMAVVGSAA
AAAALRDQLGAEAAGIDIRFGPEALEEAAAHPDCDAVMAAIVGAAGLRPTLAAVRAGKRV
LLANKEALVMSGALFMDAVRQHGATVLPIDSEHNAIFQCLPQQRPQFGHGVARIVLTASG
GPFRARAIETLTEVTPEQACAHPNWVMGRKISVDSATMMNKGLEVIEAHWLFNVPVAQLE
VLIHPQSVIHSMVAYDDGSVLAQLGNPDMRTPIAYGLAYPDRIEAGVPLLDLAATGTLAF
EAPDLHRFPCLALAFDALRAGGTAPAVLNAANEVAVEAFLQRRIRFTEIAAVVDDTLART
AIGPADSLDTVFAADAQARRRAEHYIAASCIHS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcattaccgttcttggcgccaccggttccatcggcgacagcacgctcgacgtg
gtgcgccgccaccctgaccgctaccgcgtgttcgcgctgaccgccaacgcgcaggtcgac
aagcttgccgcgctgtgccgcgatttccatccggcgatggcggtggtcggttcggccgcc
gcggctgccgcgctgcgggaccagcttggcgcggaggccgccggcatcgacatccgcttc
ggccccgaagcgctggaagaggccgccgcccatcccgattgcgatgctgtgatggccgca
atcgtcggcgcagcgggcctgcgcccgacgctggctgccgtgcgcgccggcaagcgcgtg
ctgctggccaacaaggaggcgctggtgatgtccggcgcgctcttcatggacgcggtgcgc
cagcacggcgccacggtgctgccgatcgacagcgagcacaacgccatcttccaatgcctg
ccccagcagcgcccgcagttcgggcatggtgtggcgcgcatcgtgctgacggcttcgggc
ggcccgttccgcgcgcgtgccatcgagacgctgaccgaggtcacgccggagcaggcctgc
gcccacccgaactgggtgatgggccgcaagatttccgtcgactccgccaccatgatgaac
aaggggctggaggtgatcgaggcgcactggctgttcaatgtgccggtcgcgcagctcgag
gtgctgatccacccgcagagcgtgatccattcgatggtcgcctacgacgacggctcggtc
ctggcgcagctcggcaaccccgatatgcggacgccgatcgcctacgggttggcgtacccc
gatcgcatcgaagccggtgtgccgctgctggatctggccgcgaccggcacgctggcgttc
gaggcgcccgacctgcatcgcttcccgtgcctggcgctggccttcgatgccctgcgcgcc
ggcggtacggcgcctgctgtgctgaacgcggccaacgaggtggcggtcgaggcatttttg
cagcgccgcatccgctttaccgagatcgccgcggtggtggacgatacgctggcgcgcacc
gctatcgggccggcggattcgctcgacacggtgttcgccgccgatgcacaggcgcgccgc
cgcgccgagcactatattgccgcatcgtgcattcattcgtga

DBGET integrated database retrieval system