KEGG   Ralstonia solanacearum Po82: RSPO_c01965Help
Entry
RSPO_c01965       CDS       T02005                                 

Gene name
dapE
Definition
(GenBank) N-succinyl-diaminopimelate deacylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00300  Lysine biosynthesis
rsn01100  Metabolic pathways
rsn01120  Microbial metabolism in diverse environments
rsn01230  Biosynthesis of amino acids
Module
rsn_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    RSPO_c01965 (dapE)
Enzymes [BR:rsn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     RSPO_c01965 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AEG69263
UniProt: F6G1Y0
Position
2049469..2050620
Genome map
AA seq 383 aa AA seqDB search
MSPTLALTEDLIRRRSVTPEDKGCQDVLIERLTAAGFACETVVSGPDHFRVTNLWAVKRG
RAGTDGKLLVFAGHTDVVPTGPVEQWRSDPFEPTHRDGKLYGRGAADMKTSIAGFVVASE
EFVAQHPDHAGSIGFLITSDEEGPAHDGTVKVCDLLRARGERLDYCVVGEPTSVSTLGDM
VKNGRRGSLSGKLTINGVQGHIAYPHLAKNPIHLAAPALAALVAEKWDDGNAYFPPTTWQ
MSNIHGGTGATNVIPGQVTIDFNFRFSTASTPEGLKSRVHALLDAHGLDYTLAWTLGGEP
FLTERGALSEALSSAIQAECGVATELSTTGGTSDGRFIARLCPQVIEFGPPNASIHKIDE
HVDVAFIEPLKNVYRRVLETLVA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccacgcttgccctcactgaagacctgatccgccgccgctccgtcacccccgaa
gacaagggctgccaggatgtgctgatcgaacgcctgaccgccgccggcttcgcatgcgaa
accgtggtcagcggcccggaccacttccgcgtgaccaacctgtgggccgtcaagcgcggc
cgcgcgggcaccgacggtaagttgctggtcttcgccggccacaccgacgtggtgccgacc
ggccccgtggaacagtggcgctccgacccgttcgagcccacccaccgcgacggcaagctg
tacggccgcggcgccgccgacatgaagacctcgatcgccggtttcgtggtggcctcggaa
gaattcgtcgcccagcatccggaccacgccggctcgatcggcttcctgatcaccagcgac
gaggaaggcccggcccacgacggcaccgtcaaggtgtgcgacctgctgcgcgcgcgcggc
gagcggctggactactgcgtggtcggcgagccgacctcggtgtccacgctcggcgacatg
gtcaagaacgggcggcgcggctcgctgtcgggcaagctcaccatcaacggcgtgcaaggc
cacatcgcctatccgcacctggccaagaacccgatccacctggccgcgccggcgctggcc
gccctggtggccgaaaagtgggacgacggcaatgcctacttcccgccgaccacctggcag
atgtccaacatccacggcggcacaggcgcgaccaacgtgatcccgggccaggtcaccatc
gacttcaacttccgcttctcgacggcgagcacgcccgagggcctgaagtcgcgcgtgcat
gcccttctcgacgcgcacggcctggactacacgctggcctggacgctgggcggcgagccc
ttcctgaccgagcgcggcgcgctgtcggaggcgctgtcgtcggctatccaggccgagtgc
ggcgttgccaccgagctgtcgaccaccggcggcacgtcggatggccgcttcatcgccagg
ctgtgcccgcaagtgatcgagttcgggccgcccaacgccagcatccacaagatcgacgag
cacgtcgacgtggccttcatcgagccgctgaagaacgtgtatcgccgcgtgctcgaaacg
ctggtcgcctga

DBGET integrated database retrieval system