KEGG   Ralstonia solanacearum Po82: RSPO_c02044Help
Entry
RSPO_c02044       CDS       T02005                                 

Gene name
pit
Definition
(GenBank) low-affinity phosphate transporter lipoprotein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rsn  Ralstonia solanacearum Po82
Brite
KEGG Orthology (KO) [BR:rsn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    RSPO_c02044 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 FGGY_C
Motif
Other DBs
NCBI-ProteinID: AEG69342
UniProt: F6G2X6
Position
complement(2136192..2137202)
Genome map
AA seq 336 aa AA seqDB search
MHTLQISLWVVVLLVALAILFDFMNGFHDAANSIATVVSTGVLKPQQAVAMAAVCNVIAI
FIFHLKVATTVGRDTIDPSIVDHYVIFGALLGAIAWNIITWYYGIPSSSSHALIGGLVGA
AVAKSGTGSLVASGLLKTVAFILISPLLGFILGLCLMIAVSWLFFRTPPSKVDRWFRRLQ
LLSASLYSLGHGGNDAQKTIGIIWMLLIAGGYASATAHEPPIWVIVCCYVAIGLGTLLGG
WRIVRTMGQKITKLKPVGGFCAETGGALTLFLASAMGVPVSTTHTITGAIVGVGAAQKAS
AVRWGVAGNIVWAWVLTIPASAFMAAIAWWIGRQLL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcacacactccagatcagtctttgggtggtcgttctgctggtggcgctggccatcctg
ttcgatttcatgaacggcttccacgatgcggccaattccatcgccacggtggtgtcgacc
ggcgtgctcaagccgcagcaggcggtggcgatggccgcggtctgcaacgtgatcgccatt
ttcatctttcacctcaaggtcgcgacgacggtggggcgcgacaccatcgacccgagcatc
gtcgaccactacgtcatcttcggcgccctgctcggggcgatcgcctggaacatcatcacg
tggtattacggcattccgtccagctcgtcgcacgcgttgatcggcggactggtcggggcg
gccgtggccaagtcgggcacgggctcgctggtggccagcggtctgctcaagacggtggcg
ttcatcctgatttcgccgttgctggggttcattctcggcttgtgcctgatgatcgcggtg
tcctggctgttcttccgcacgccgccttccaaggtggaccggtggttccggcggctgcag
ttgctgtcggcctcgctgtacagcctgggccacggcggcaacgatgcgcagaagaccatc
ggcatcatctggatgctgctgatcgccggcggctatgcttcggcgacggcgcatgagcca
ccgatctgggtgatcgtctgctgctacgtggcgatcgggctgggcacgctgctgggaggc
tggcgcattgtccggaccatggggcagaagatcaccaagctcaagccggtgggcggtttc
tgcgctgaaaccggtggtgcgctgacgctgttcctcgcttcggcgatgggcgtgccggtt
tcgaccacgcataccatcaccggcgccatcgtcggcgtgggcgcggcgcagaaggcgtcg
gccgtgcggtggggcgtcgccggcaatatcgtctgggcctgggtcctgacgatcccggca
tcggccttcatggcggcgatcgcctggtggatcggccggcaactgctctga

DBGET integrated database retrieval system