KEGG   Ralstonia solanacearum Po82: RSPO_c02919Help
Entry
RSPO_c02919       CDS       T02005                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00071  Fatty acid degradation
rsn00280  Valine, leucine and isoleucine degradation
rsn00281  Geraniol degradation
rsn00362  Benzoate degradation
rsn00592  alpha-Linolenic acid metabolism
rsn00642  Ethylbenzene degradation
rsn01100  Metabolic pathways
rsn01110  Biosynthesis of secondary metabolites
rsn01120  Microbial metabolism in diverse environments
rsn01130  Biosynthesis of antibiotics
rsn01212  Fatty acid metabolism
Module
rsn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rsn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RSPO_c02919
   00592 alpha-Linolenic acid metabolism
    RSPO_c02919
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSPO_c02919
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    RSPO_c02919
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RSPO_c02919
   00642 Ethylbenzene degradation
    RSPO_c02919
Enzymes [BR:rsn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     RSPO_c02919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEG70211
UniProt: F6G5B0
Position
complement(3045385..3046584)
Genome map
AA seq 399 aa AA seqDB search
MTKQLQDAYIVAATRSPIGKAPKGSFKNLRPDDLLATVLKSAVAQVPNLDPKLIEDAIVG
CAIPEAQQGLNVARIGALLAGLPNTVGGVTVNRFCASGLTAVAMAADRIRVGESDVMIAA
GVESMSMVPMMGNAPSMSPSIFERDENIGIAYGMGLTAEKVAQQWKITRDAQDAFSLASH
QKALAAQQAGEFKDEITPIEIIEKFPNLGTGAIDLKTRTLSLDEGPRADTSLEGLAKLRA
VFANKGSVTAGNSSQTSDGSGALILVSEKILKQFNLTPLARFVSFAVRGVPPEIMGIGPK
EAIPAALKAGGLTQDQIDWIELNEAFAAQSLAVIQDLGLDTGKVNPLGGAIALGHPLGAT
GAIRAATVVHGLRRRNLKYGMVTMCVGTGMGAAGIFERV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcaactgcaagacgcctacatcgtcgccgccacccgctccccgatcggcaag
gcgcccaagggctcgttcaagaacctgcgtccggacgacctgctggccaccgtgctcaag
agcgcggtggcccaggtgccgaacctggacccgaagctgatcgaagacgccatcgtcggc
tgcgcgattcccgaagcgcagcagggcctgaacgtggcgcgcatcggcgcgctgctggcc
ggcctgccgaacacggtgggcggcgtgaccgtcaaccgcttctgcgcctcgggcctgacc
gccgtggcgatggccgccgaccgcatccgcgtaggcgaatccgatgtgatgatcgccgcc
ggtgtcgagtcgatgagcatggtgccgatgatgggcaatgcgccgtcgatgtcgccgtcg
atcttcgagcgcgacgagaacatcggcattgcctacggcatgggcctgaccgccgagaag
gtcgcccagcagtggaagatcacgcgcgatgcgcaggacgcgttctcgctggcgtcgcac
cagaaggcattggccgcgcagcaggccggcgagttcaaggacgagatcaccccgatcgag
atcatcgagaaattccccaacctgggcactggcgcgatcgacctgaagacgcgcacgctg
tcgctcgacgaaggcccgcgtgccgatacgtcgctcgaagggctggccaagctgcgcgcg
gtgttcgccaacaagggcagcgtgacggcgggcaacagctcgcagacgtcggatggttcg
ggtgcgttgatcctggtgtcggagaagattctcaagcagttcaacctgacgccgctggcg
cgcttcgtgtcgttcgcggtgcgcggcgtgccgccggagatcatgggcatcggcccgaag
gaagcgattccggccgcgctcaaggccggtgggctgacgcaggaccagatcgactggatc
gagctgaacgaagcgtttgccgcgcagtcgctggcggtcatccaggacctgggcctggac
accggcaaggtcaacccgctgggcggcgcgatcgcgctgggccacccgctgggcgcgacc
ggggccatccgcgcggccaccgtcgtgcacggcctgcgccgtcgcaacctgaagtacggc
atggtgacgatgtgcgtcggcaccggcatgggcgccgcgggtatcttcgaacgcgtctga

DBGET integrated database retrieval system