KEGG   Ralstonia solanacearum Po82: RSPO_c03207Help
Entry
RSPO_c03207       CDS       T02005                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00220  Arginine biosynthesis
rsn00330  Arginine and proline metabolism
rsn01100  Metabolic pathways
rsn01110  Biosynthesis of secondary metabolites
rsn01130  Biosynthesis of antibiotics
rsn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    RSPO_c03207 (rocF)
   00330 Arginine and proline metabolism
    RSPO_c03207 (rocF)
Enzymes [BR:rsn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RSPO_c03207 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEG70498
UniProt: F6G5S1
Position
3327874..3328803
Genome map
AA seq 309 aa AA seqDB search
MTIIDLIGAAIGCGAQDDGCRDGPRALLQAGALQRLQTPDTHGGLVHDIELTTPAGHSRS
ARLAALPGVAGFSRALADATAHSVHEEHVPVVIGGDHSCAIGTWSGVASALRPAGPLGLI
WIDAHLDSHTPQTSDSGAIHGMPLAALLGHGPRELTQVRDAGPKLLPQHVVVIGARSYEP
AERALIDRLGVRVIDAGEVARGGLRAVMADAIRIVTADTAAFGVTLDLDAFDPAVAPGVG
SPEPGGLTGQDMTQALAACARDARFAAFELVEYNPRHDKGGITARLALDLLSAVAGALHA
QRRAYASAA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcatcgacctgatcggcgcggccatcggctgcggcgcgcaagacgacggctgc
agggacggcccgcgcgcgctgctgcaggccggcgcgctgcagcggctgcagacacccgac
acgcacggcggcctggtgcacgacatcgagttgacgacaccggccggccacagccgctcg
gcccggctggcggcgctgcccggcgtggccgggttctcgcgcgcgctggccgatgcgacg
gcgcacagcgtgcacgaagagcacgtgccggtcgtcatcggcggcgatcactcgtgcgcg
atcggcacgtggtcgggcgtggcctcggcgctgcggccggccggcccccttggactgatc
tggatcgacgcccacctggacagccacaccccgcagaccagcgactccggcgccatccac
ggcatgccgctggcggcgctgctcggccacggcccgcgcgagctgacgcaggtgcgcgat
gcgggccccaagctgctgccgcagcacgtggtggtgatcggcgcgcgcagctacgagccg
gccgagcgcgcgctgatcgaccgcttgggcgtgcgcgtgatcgatgccggggaagtcgcc
cgcggcggcctgcgcgcggtgatggccgacgccatccgcatcgtcacggccgacacggcg
gccttcggggtcacgctcgacctggatgccttcgatccggccgtggcgcccggcgtgggc
tcgccggaaccgggcggcctcacggggcaggacatgacgcaggcgctggccgcctgcgcc
cgcgatgcgcgcttcgcggccttcgaactggtggaatacaacccgcgccacgacaagggc
gggatcaccgcacggctggcactggacctgctgagcgccgtcgcgggcgcgctgcacgcc
cagcgccgcgcctatgcaagcgcggcctga

DBGET integrated database retrieval system