KEGG   Ralstonia solanacearum Po82: RSPO_m01071
Entry
RSPO_m01071       CDS       T02005                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
rsn  Ralstonia solanacearum Po82
Brite
KEGG Orthology (KO) [BR:rsn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rsn02044]
    RSPO_m01071
Secretion system [BR:rsn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RSPO_m01071
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AEG71708
UniProt: F6G9C0
Position
megaplasmid:1204588..1206078
AA seq 496 aa
MLDNQSAALAQSAPAAEAVNLLDQIVDQSRVAKSDAEHARAKDIIGELVNQVLQGTVVVS
DNLSATLDARVAELDRLISSQLSAVMHAPEFQKLESTWRGLSYLVQETQTGTMIKIKVLN
ATKRDLVRDFKTAIDFDQSALFKKVYEEEFGTFGGAPFGTLIGDFDVTRQPEDVYFIEQM
SHVAAAAHAPFIASSSPELFGLESFADLGKPRDLAKVFDTVEYAKWKSFRESEDSRYVGL
TMPRFLGRLPYNPKDGTTVEGFNFVEDVDGTDHSKYLWCNAAWAFGARLTAAFEDFGWCA
AIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFIPLVHCKNSDY
AAFFAAQSVQKPKKYDTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAKNV
ETFLNRWISQYVLLDDNATQEQKAQFPLREASIQVSEVPGKPGTYRSVAFLRPHFQLDEL
SISLRLVADLPKPTNS
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgcttgacaaccaatccgccgcgctcgcgcagagcgcaccggcagccgaggccgtcaac
ctgctcgaccagatcgtcgaccagagccgtgtcgccaagtcggacgccgagcacgcacgc
gccaaggacatcatcggcgagctggtcaaccaggtgctgcagggcacggtggtggtgtcc
gacaacctgtcggccacgctggatgcccgcgtggccgagctggatcgcctgatctcgtcg
cagttgagcgccgtcatgcatgcgcccgaattccagaagctggaaagcacgtggcggggc
ttgtcgtacctggtccaggaaacgcagaccggcacgatgatcaagatcaaggtgctcaac
gccaccaagcgagacctcgtgcgcgacttcaagacggccatcgatttcgatcagagcgcg
ctgttcaagaaggtgtacgaagaggagttcggcaccttcggcggcgcgccgttcggcacg
ctgatcggcgatttcgacgtcacgcgccagccggaagacgtgtacttcatcgagcagatg
tcgcacgtggccgcggccgcgcacgcgccgttcatcgcctcgtcgtcgccggagctgttc
ggcctggaatcgtttgccgacctgggcaagccgcgcgacctggccaaggtgttcgatacg
gtcgagtacgccaagtggaagtcgttccgcgagtcggaggattcgcgctacgtgggcctg
acgatgccgcgcttcctgggccggctgccgtacaaccccaaggatggcaccaccgtcgag
ggcttcaacttcgtcgaagacgtggacggcaccgaccacagcaaatacctgtggtgcaac
gccgcctgggcgttcggtgcgcggctgaccgccgcgttcgaagacttcggctggtgcgcg
gcgatccgcggggtggaaggcggcgggctggtcgaagacctgccgacgcataccttcaag
accgacgatggcgagatcgcgctcaagtgcccgacggaaatcgccatcaccgatcgccgc
gagaaggagctgagcgacctgggcttcatcccgctcgtgcactgcaagaactcggactat
gccgcgttcttcgcggcgcagtcggtgcagaaacccaagaagtacgacaccgacagcgcg
aacgccaacgcggtgctgtcggcgcagttgcagtacatcttttcggtatcgcgcgtggcg
cactacctgaaggcgatgatgcgcgacaagatcggcagcttcgcgtcggccaagaacgtc
gagaccttcctcaaccggtggatctcgcagtacgtcctgctggacgacaacgccacccag
gagcagaaggcgcaattcccgctgcgcgaagcctcgatccaggtgtccgaagtgcccggc
aagcccggtacgtaccgctcggtggcgttcctgcggccgcacttccagctcgatgaactg
tcgatctcgctgcggctggtggcggacctgcccaagccaaccaattcctga

DBGET integrated database retrieval system