KEGG   Ralstonia solanacearum Po82: RSPO_m01072
Entry
RSPO_m01072       CDS       T02005                                 

Gene name
sciK
Definition
(GenBank) secretion system protein (evpc-like), hemolysin-coregulated protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rsn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RSPO_m01072 (sciK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rsn02044]
    RSPO_m01072 (sciK)
Secretion system [BR:rsn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RSPO_m01072 (sciK)
SSDB
Motif
Pfam: T6SS_HCP FAM27
Other DBs
NCBI-ProteinID: AEG71709
UniProt: F6G9C1
Position
megaplasmid:1206167..1206670
AA seq 167 aa
MKDIYVKFDSPAIKGESQDKDHKDWIEVNSWSQSIVQPRSATASTAGGHTAERCEHRDMV
FTKDLDVVSPLLYQHASGGTTFGEVSIEFFRADGEGNRVKYLEIKLKNAILSEVDSQVAA
QGIPTDTFSLRYAAVQWKYTQQKSAGGQGGNSQGAWSLTKNDKTYSV
NT seq 504 nt   +upstreamnt  +downstreamnt
atgaaggatatctacgtcaagttcgacagcccggccatcaagggggagtcgcaggacaag
gatcacaaggactggatcgaagtcaacagctggtcccagtcgatcgtccagccgcgttcg
gctacggcctcgaccgcgggcggccacaccgccgagcgttgcgagcaccgcgacatggtg
ttcaccaaggacctggacgtggtcagcccgctgctgtaccagcacgcttcgggcggtacg
accttcggtgaagtgtcgatcgagttcttccgcgccgacggcgaaggcaaccgcgtgaag
tacctcgagatcaagctgaaaaacgcgatcctgagcgaagtggactcgcaggtggctgcc
cagggcatcccgaccgacacgttcagcctgcgctatgcagccgtgcagtggaagtacacg
cagcagaagagtgccggcggccagggcggcaactcgcagggcgcatggagcctcaccaag
aacgacaagacctactcggtttaa

DBGET integrated database retrieval system