KEGG   Ralstonia solanacearum Po82: RSPO_m01074
Entry
RSPO_m01074       CDS       T02005                                 

Definition
(GenBank) protein of unknown function duf879, bacterial
  KO
K11896  type VI secretion system protein ImpG
Organism
rsn  Ralstonia solanacearum Po82
Brite
KEGG Orthology (KO) [BR:rsn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rsn02044]
    RSPO_m01074
Secretion system [BR:rsn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RSPO_m01074
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AEG71711
UniProt: F6G9C3
Position
megaplasmid:1207267..1209117
AA seq 616 aa
MEELLPYYERELAFLRRYSRDFAERYPKIAGRLAMSGDGCDDPHVERMIESFSLLTARVS
KKLDDDYPEFTEALLEVLYPHYLRPFPSCSVVHFDVRGVAAQISAPMLIPRGTFLTSRVV
RKVECRFRTAYDVTFAPVRIAAAAFERAVSAPSAVSLPKGATGAIALTLEYVGERGGFES
LPLDRLRVYMDGEPSFVAALGDALFLQTAAAYVEGERPGVWTRLSGVPLQAVGFTEDEAL
IDCPPRSHPAYRLLTEHFSFAEKFNFFDIDLAAVRRGLTPGVPVRQLVLHLVLKDVRSDS
HAARLLEGLQADHLRLHCTPVVNLFQQMADPIRIEHTASAYPVVADSRRAHGFDIYSIDK
VHLVRETAAHEEVTEFRPFYSLHHGEEPGQSGHYWIARRNELVAQRSPGFETEISIVDTQ
FDPASPQTDTLSLTVTCTNRDLPSTLAFGQPEGDLSMEGGSIARSITFLRKPTPSMRLGG
GRAAQWRLISLLALNHLSLVQNGLPTLKEMLRLHDLPHSAISARQVEGIVGLDYAPATRW
LAGKPFATFVRGLEIRLTLDEDAFVGTGLHRFIRVLDHFFGLYVHINSFVQLIAVSRRSG
KELVRCAPRSGESILV
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggaagaactgctgccctattacgaacgagaactggccttcctgcgccggtactcgcgc
gacttcgccgagcgctacccgaagatcgccggtcgcctcgccatgtcgggcgacggctgc
gacgatccgcacgtcgagcggatgatcgagtcgttctcgctgctgaccgcgcgcgtcagc
aagaagctggacgacgactaccccgaattcaccgaggcgttgctggaggtcctgtacccc
cactaccttcgcccgttcccgtcgtgctccgtggtgcatttcgacgtgcgcggcgtggcg
gcgcagatcagcgcgccgatgctgatcccgcgcggcacgttcctgacttcgcgcgtggtg
cgcaaggtcgagtgccgtttccgcaccgcctacgatgtcaccttcgcgccggtgcggatc
gctgcggccgcgttcgagcgcgccgtgtccgcgccgtcggcggtcagcttgcccaagggg
gcgaccggtgcgatcgcgctgacgctggagtacgtcggcgagcgcggcggcttcgagtcc
ttgccgctcgaccggctgcgcgtctacatggacggcgagccctcgttcgtggccgcgctg
ggggatgcgctgttcctgcagacggcggcggcctatgtggagggcgagcgccccggcgtg
tggacccgcctgtccggcgtgccgctgcaagcggtcggctttacagaagacgaggcgctg
atcgattgcccaccgcgctcgcatccggcctatcggctgctgaccgagcatttcagcttt
gccgagaaattcaatttcttcgacatcgacctggcggccgtgcggcgcgggttgacgccc
ggcgtgccggtccgccaactggtgctgcacctggtcctgaaggacgtgcgcagcgactcg
catgccgcccgcctgctcgagggcctgcaggccgaccacctgcgcctgcattgcacgccg
gtggtcaacctgttccagcagatggcagatccgatccgtatcgagcacacggccagcgcc
tatccggtcgtggccgacagccgccgcgcgcacggcttcgatatctactcgatcgacaag
gtgcacctggtgcgcgagaccgccgcgcacgaagaggtgaccgagttccgcccgttctac
tcgctgcatcacggcgaggagcccgggcagtcgggccactactggatcgcgcggcgcaac
gagctggtggcgcagcgcagccccggcttcgagaccgagatttccatcgtcgatacgcag
ttcgacccggccagcccgcagaccgatacgctgagcctgaccgtcacctgcaccaaccgc
gatctgccgtccacgctggcattcggccagccggagggcgacctgtcgatggagggcggc
tcgatcgcccgcagcatcacgttcctgcgcaagccgacgccgtcgatgcggctgggcggc
gggcgggcggcgcagtggcggctgatctcgctgctggcgctcaaccatctgtcgctggtg
cagaacgggctgccgacgctcaaggagatgctgcgcctgcacgatctgccgcacagcgcc
atttcggcgcggcaggtcgagggcatcgtcggtctcgactacgcgccggccacgcgctgg
ctggccggcaagccgttcgccaccttcgtgcgggggctggagatccggctcacgctggac
gaagacgcctttgtcggcacgggcctgcatcgattcatccgcgtgctggaccacttcttc
ggtctgtacgtccacatcaacagctttgtgcagctgatcgcggtatcgcgccgcagcggc
aaggaactggtcagatgcgcaccccgcagcggcgaatcgatcctggtgtga

DBGET integrated database retrieval system