KEGG   Ralstonia solanacearum Po82: RSPO_m01075Help
Entry
RSPO_m01075       CDS       T02005                                 

Definition
(GenBank) protein of unknown function duf1305
  KO
K11895  type VI secretion system protein ImpH
Organism
rsn  Ralstonia solanacearum Po82
Brite
KEGG Orthology (KO) [BR:rsn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rsn02044]
    RSPO_m01075
Secretion system [BR:rsn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RSPO_m01075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG
Motif
Other DBs
NCBI-ProteinID: AEG71712
UniProt: F6G9C4
Position
megaplasmid:1209081..1210184
Genome map
AA seq 367 aa AA seqDB search
MRTPQRRIDPGVIRRLLRQPYRYEFFQAVRLLEQLFARRGNAAPEHALATRVSFRNTLAL
SFPPSELQAIEAGSVTPDMLESDAAFMAALDDGALDTVAITPTFFGMLGVQGALPLRYTE
IVAEREAVWRDRAARAFFDMFSNRATALFYLAWKKYRLPFQYEVDNNRHYLPLLLSLAGV
TDRTLRSDLSGTPGPVHDEALAGYATAIRHRPVSAAYLQRVLADYFQAPVRVEQFVGNWY
RVPPSQYSRLGGTNNVLGATALAGERVWQRDLRVRVWVGPLARAQYRNFLPGAPGALALR
KMLTILCGATLEFEIKLILRRQDVAGCTLGAQAGGHGAGRLGWDTFLCSRPAQHDRSDAQ
YTLEPLH
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccccgcagcggcgaatcgatcctggtgtgatccgcaggctgctgcggcagccg
taccggtatgagttcttccaggccgtacggctgctggagcagctgtttgcgcgccggggc
aatgccgcccccgagcatgcgctggccacgcgcgtgagcttccgcaatacgctggccctg
tcgttcccgcccagcgagctgcaggccatcgaggccgggagcgtgacgcctgacatgctg
gagagcgatgcggccttcatggcggcgctcgacgacggcgcgctcgataccgtggccatc
acgccgaccttcttcggcatgctcggcgttcagggggcgctgccgctgcgctataccgag
atcgtggccgagcgcgaggccgtgtggcgcgaccgcgcggcgcgggcctttttcgacatg
ttctcgaaccgcgcgacggcgctgttctacctggcctggaagaagtaccggctgccgttc
cagtacgaagtcgacaacaaccggcattacctgccgctgctgctgtcgctggccggcgtc
acggatcgcacgctgcgcagcgatctgtccggcacgccggggccggtccatgacgaagcg
ctggccggctatgccacggcgatccgccatcggccggtgtcggcggcgtacctgcagcgg
gtgctggcggactatttccaggcgccggtgcgcgtcgagcagttcgtcggcaactggtat
cgcgtgccgccatcgcagtattcacggctgggcggcaccaacaacgtgctcggcgccacc
gcgctggccggcgagcgcgtctggcagcgcgacctgcgggtgcgcgtgtgggtcggtccg
ctggcgcgcgcgcagtaccgcaacttcctgccgggggcgcccggtgcactggcgctgcgc
aagatgctgacgatcctgtgcggcgccacgctcgaattcgaaatcaagctgatcctgcgc
cgccaggatgtggccggctgcacgctgggcgcgcaggccggtggccacggtgccggccga
ctgggctgggacaccttcctgtgctcgcgtccggcgcagcacgaccgcagcgacgcgcag
tacaccctcgaaccgctgcattga

DBGET integrated database retrieval system