KEGG   Ralstonia solanacearum Po82: RSPO_m01149Help
Entry
RSPO_m01149       CDS       T02005                                 

Gene name
wcaG
Definition
(GenBank) nad-dependent epimerase/dehydratase; protein
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00053  Ascorbate and aldarate metabolism
rsn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    RSPO_m01149 (wcaG)
Enzymes [BR:rsn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     RSPO_m01149 (wcaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_4 RmlD_sub_bind NAD_binding_10 Polysacc_synt_2 NmrA
Motif
Other DBs
NCBI-ProteinID: AEG71785
UniProt: F6GAJ7
Position
megaplasmid:1293515..1294363
Genome map
AA seq 282 aa AA seqDB search
MTTIDTQTSADPLAGVATRCGRLLLTGAGGNLGKVLRERLACYADVLRLSDIADLGAARA
GEEVAPCNLADAKAVDALVEGVDAIVHLGGISVERPFEEILPANIQGTYHLYEAARRHGV
KRIVFASSNHAIGFYRQGEVIDARVPTRPDGYYGLSKVFGEQLGSFYFDRYGIETVAIRI
GSSFPEAKDRRMLVTWLGYDDLEQLICRALFVPRVGFTIVYGMSGNRETWWDNRHAAHLG
YVPTQGSEAFRARVEAQPPLAADDPAAQFQGGAFVKAGPFGD
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatcgatacccagacatccgccgatccgctggccggtgtcgccacgcgctgc
ggccggctcctgctgaccggtgcgggcggcaacctcggcaaggtgctgcgcgagcggctc
gcgtgctacgccgatgtgctgcgcctgtccgacattgccgacctgggcgccgcgcgcgcg
ggcgaggaagtcgcgccgtgcaacctggccgatgcaaaggcggtcgatgcgctggtcgag
ggcgtggacgcgatcgtccacctgggcggcatctcggtcgagcggccgttcgaagagata
ttgccggccaacatccagggcacctatcacctgtacgaagcggcgcgccggcatggcgtg
aagcgcatcgtcttcgccagctcgaaccacgccatcggcttctaccggcagggcgaggtc
atcgatgcgcgcgtgccgacgcggcccgacggctactacgggttgagcaaggtgttcggc
gagcagctcggcagcttctatttcgaccgctacggcatcgagaccgtcgccatccgcatc
ggctcgtcgttccctgaggcgaaggaccgccgcatgctggtcacctggctcggctacgac
gacctggaacagctgatttgccgcgcgctgttcgtgccgcgcgtgggcttcaccatcgtc
tatggcatgtcgggcaaccgcgagacgtggtgggacaaccgccacgccgcgcacctcggc
tacgtgcccacgcagggcagcgaagccttccgcgcccgggtcgaagcgcagccgccgctg
gcggccgacgatccggcggcgcagttccagggcggcgccttcgtcaaggccggcccgttc
ggagactga

DBGET integrated database retrieval system