KEGG   Ralstonia solanacearum GMI1000: RSc1695
Entry
RSc1695           CDS       T00071                                 
Name
(GenBank) probable phage hk022 gp19-related protein
Organism
rso  Ralstonia solanacearum GMI1000
SSDB
Motif
Pfam: Prok-JAB NLPC_P60 RadC
Other DBs
NCBI-ProteinID: CAD15397
UniProt: Q8XYR3
Position
1812143..1812853
AA seq 236 aa
MQETTLDAARRHAAREHPREACGLVVVVRGRERYMACRNVAVGTEHFEMPAEDYAAAEDL
GEVLAVVHSHPNASAEPSEADRVACEASGLPWHIIAWPADDVRTITPCGYRAPLVGRQFA
HGILDCYSLVADWYERERGIHLQDFERRDNWWAEGGDLYMQHYAEAGFRVVSQDTPERVG
DVILMQVRSPVPNHAAVYLGGGLMLHHLHGRLSSRDVYGGYWREITRCVLRHHSEG
NT seq 711 nt   +upstreamnt  +downstreamnt
atgcaagaaacaacactcgacgcggcgcgccggcacgccgcgcgcgaacacccgcgcgaa
gcttgtggcctggtggtggtcgtccgtggtcgcgagcgctacatggcgtgccgcaacgtg
gctgtcggcaccgagcatttcgagatgccggccgaggactacgcggcggccgaggatctt
ggcgaagtgctggcggtggtgcacagccacccgaacgccagcgcggagcccagcgaggcc
gatcgcgtggcctgtgaggcgtccggcctgccctggcacatcatcgcgtggccggccgac
gacgtgcgcacgatcacgccgtgcggctaccgggcgccgctggtgggccgccagttcgcg
cacggcatcctcgactgctattcgctggtggccgattggtacgagcgcgagcggggtatc
cacctgcaggatttcgagcggcgtgacaactggtgggccgagggcggcgacctgtacatg
cagcactacgcggaggctggatttcgggttgtatcgcaggacacgccggagcgcgtcggc
gacgtgattctcatgcaggtgcgctcgccggtgccgaaccacgcggcggtctacctgggc
ggcgggctgatgctgcatcacctgcatggccgcctgtcgtcgcgggacgtgtatggcggc
tactggcgcgagatcacgcgctgcgtgctgcgtcaccacagtgaggggtag

DBGET integrated database retrieval system