KEGG   Ralstonia solanacearum GMI1000: RSc0554Help
Entry
RSc0554           CDS       T00071                                 

Gene name
sucC
Definition
(GenBank) probable succinyl-coa synthetase beta chain (scs-beta) protein
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00020  Citrate cycle (TCA cycle)
rso00640  Propanoate metabolism
rso00660  C5-Branched dibasic acid metabolism
rso01100  Metabolic pathways
rso01110  Biosynthesis of secondary metabolites
rso01120  Microbial metabolism in diverse environments
rso01130  Biosynthesis of antibiotics
rso01200  Carbon metabolism
Module
rso_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rso_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSc0554 (sucC)
   00640 Propanoate metabolism
    RSc0554 (sucC)
   00660 C5-Branched dibasic acid metabolism
    RSc0554 (sucC)
Enzymes [BR:rso01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RSc0554 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: CAD14082
UniProt: Q8Y1Y3
Position
598777..599943
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQGKEILRKYNVPVPRGIPAFSVEEALKAAETLGGPVWVVKAQIHAGGRGKGGGV
KVAKSMDEVKTYASNILGMTLVTHQTGPEGKKVNRLLIEEGADIKKELYVSLVVDRVSQK
VALMASSEGGMDIEEVAAHTPEKIHTLIVDPQIGLQDAEADDIARKIGVPDASVPQARQA
LQGLYKAFWETDASLAEINPLILTGDGKVIALDAKFNFDSNALFRHPEIVAYRDLDEEDA
NEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPGLKAILVNIFGGIMRCDVIAEGVIAASKAVSLSVPLVVRMKGTNEDLGKKM
LADSGLPIIAADTMEEAAQKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccaaggcaaggaaatcctgcgcaaatacaatgtgccggttccg
cgcggcattccggctttttcggtcgaagaggccctgaaggccgctgaaaccctgggcggc
ccggtgtgggtcgtgaaggcgcagattcatgcgggcggccgcggcaagggcggcggcgtg
aaggttgccaagagcatggacgaggtgaagacctacgccagcaacatcctgggcatgacc
ctggtgacgcaccagaccggcccggaaggcaagaaggtcaaccgcctgctgatcgaagaa
ggcgcggacatcaagaaggaactgtacgtgtcgctggtggtggaccgcgtctcgcagaag
gtcgccctgatggcctccagcgaaggcggcatggacatcgaagaagtcgctgcccacacc
ccggaaaagatccacacgctgatcgtcgatccgcaaatcggcctgcaagacgctgaagcc
gacgacatcgcccgcaagatcggcgtgcccgacgcgagcgtgccgcaagcccgccaagcc
ctgcaaggcctgtacaaggcattctgggaaaccgacgcttcgctggcggaaatcaacccg
ctgatcctgaccggcgacggtaaggtcatcgcgctggacgccaagttcaacttcgactcc
aacgcgctgttccgtcacccggaaatcgtcgcctaccgcgacctggatgaagaagacgcc
aacgaaatcgaagcctcgaagttcgatctggcctacatctcgctcgacggcaacatcggc
tgcctggtgaacggcgccggcctggccatggccaccatggacaccatcaagctgttcggc
ggcgagccggccaacttcctcgacgtgggcggcggcgccaccaccgagaaggtcaccgaa
gccttcaagctgatgctgaagaacccgggcctgaaggccatcctggtgaacatcttcggc
ggcatcatgcgctgcgacgtgatcgccgaaggcgtgatcgccgcgtcgaaggccgtgtcg
ctgtcggtgccgctggtggtccgcatgaagggcaccaacgaagacctcggcaagaagatg
ctggccgactcgggtctgcccatcatcgccgccgacacgatggaagaggccgcccagaag
gtcgtggccgcagccgccggcaagtaa

DBGET integrated database retrieval system