KEGG   Ralstonia solanacearum GMI1000: RSc1034Help
Entry
RSc1034           CDS       T00071                                 

Definition
(GenBank) hypothetical oxidoreductase protein
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00030  Pentose phosphate pathway
rso00260  Glycine, serine and threonine metabolism
rso00620  Pyruvate metabolism
rso00630  Glyoxylate and dicarboxylate metabolism
rso01100  Metabolic pathways
rso01110  Biosynthesis of secondary metabolites
rso01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RSc1034
   00620 Pyruvate metabolism
    RSc1034
   00630 Glyoxylate and dicarboxylate metabolism
    RSc1034
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSc1034
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     RSc1034
    1.1.1.81  hydroxypyruvate reductase
     RSc1034
    1.1.1.215  gluconate 2-dehydrogenase
     RSc1034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: CAD14736
UniProt: Q8Y0K9
Position
1086737..1087741
Genome map
AA seq 334 aa AA seqDB search
MKPGILVTRAIFPEVLARLRETFDVADNQADAVHPPEALAERLQGRVGLLANAADAINAD
LIARVPTLRAVANMAVGYNNLDLPAMTRAGILATNTPDILTETTADFGWALLMAAARRVP
ESERWLRAGHWKRWTYDMFLGAEVHGSTLGILGMGRIGQALARRASGFSMRVIYHNRSRL
SPEIERDTRATYVGKDELLAQADHLVLVLPYSSESHHAIGAAELARMKPTATLVNLARGG
IVDDAALARALAEKRLFAAGLDVYEGEPAVHPALLEAEPVSLTPHIASATHGTRLGMANL
AADNLIAALGFGPRAGQPPNLLNPEALSVRRASA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccggaatccttgtcacccgcgcgatctttcccgaagtgctggcgcggctgcgc
gagaccttcgacgtggccgacaaccaggcggatgccgtccatccgcccgaggcattggcc
gagcgcctgcagggccgcgtgggcctgctcgccaacgccgccgatgccatcaacgccgac
ctgatcgcccgcgtgccgaccctgcgcgcggtcgccaacatggcggtcggctacaacaac
ctggacctgccggcgatgacccgcgcgggcattctcgccaccaacacgccggacatcctg
accgagaccaccgccgatttcggctgggcactgctgatggcggccgcgcggcgcgtgccg
gaatcggagcgctggctgcgcgcgggccactggaagcgctggacgtacgacatgtttctc
ggtgccgaggtccatggcagcacgctgggcatcctcggcatggggcgcatcggccaggcg
ctggcgcggcgcgcgagcggcttttcgatgcgcgtgatctatcacaaccgcagccggctg
tcgcccgagatcgagcgggacacccgcgccacctacgtcggcaaggacgaactgctggcc
caggccgaccacctcgtgctggtgctgccgtattccagtgagagccatcacgccatcggc
gcggcggaactggcgcgcatgaagccgaccgccacgctggtcaacctcgcgcgcggcggc
atcgtcgacgacgcggcgctggcgcgggcgctggccgaaaaacgcctcttcgcggccggg
ctggacgtgtacgagggggagccggcggtgcatccggctctgctggaggccgagcctgtc
tcactgacgccgcatatcgccagcgccacgcacggcacgcggctcggcatggccaacctg
gccgccgacaacctgatcgccgcgctgggcttcggtccgcgcgccgggcagccgcccaat
ttgttgaacccggaggcgctgtcggtacggcgcgcctccgcctga

DBGET integrated database retrieval system