KEGG   Ralstonia solanacearum GMI1000: RSc1632Help
Entry
RSc1632           CDS       T00071                                 

Gene name
phbA
Definition
(GenBank) probable acetyl-coa acetyltransferase (acetoacetyl-coa thiolase) protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00071  Fatty acid degradation
rso00072  Synthesis and degradation of ketone bodies
rso00280  Valine, leucine and isoleucine degradation
rso00310  Lysine degradation
rso00362  Benzoate degradation
rso00380  Tryptophan metabolism
rso00620  Pyruvate metabolism
rso00630  Glyoxylate and dicarboxylate metabolism
rso00640  Propanoate metabolism
rso00650  Butanoate metabolism
rso00900  Terpenoid backbone biosynthesis
rso01100  Metabolic pathways
rso01110  Biosynthesis of secondary metabolites
rso01120  Microbial metabolism in diverse environments
rso01130  Biosynthesis of antibiotics
rso01200  Carbon metabolism
rso01212  Fatty acid metabolism
rso02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RSc1632 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    RSc1632 (phbA)
   00640 Propanoate metabolism
    RSc1632 (phbA)
   00650 Butanoate metabolism
    RSc1632 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RSc1632 (phbA)
   00072 Synthesis and degradation of ketone bodies
    RSc1632 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSc1632 (phbA)
   00310 Lysine degradation
    RSc1632 (phbA)
   00380 Tryptophan metabolism
    RSc1632 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RSc1632 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RSc1632 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RSc1632 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rso04147]
    RSc1632 (phbA)
Enzymes [BR:rso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RSc1632 (phbA)
Exosome [BR:rso04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RSc1632 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt gag-asp_proteas ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CAD15334
UniProt: Q8XYX4
Position
1753213..1754394
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAVRTAVGKFGGSLAKIPAPELGAAVIREALSRAKVAPDQVSEVIMGQVLTAG
SGQNPARQALIKAGLPDMVPGMTINKVCGSGLKAVMLAANAIVAGDADIVVAGGQENMSA
APHVLPGSRDGFRMGDTKLIDSMIVDGLWDVYNQYHMGITAENVAKQYGITREAQDAFAV
ASQNKAEAAQKSGRFNDEIVPILIPQRKGDPIAFAQDEFVRHGATLESMTGLKPAFDKAG
TVTAANASGLNDGGAAVVVMSAARAKELGLTPLATIRAYANAGVDPKVMGMGPVPASKRC
LSRAGWSVGDLDLMEINEAFAAQALAVHQQMGWDTAKVNVNGGAIAIGHPIGASGCRILV
TLLHEMQKRDAKKGLASLCIGGGMGVALAVERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgtagtgatcgtatcggcggtccgtaccgccgtgggcaagtttggcggttcg
ctggcgaaaatccccgcgccggagctgggtgcggccgtgatccgcgaagcgctgtcgcgc
gccaaggtggcgccggatcaggtcagcgaagtcatcatgggccaggtgctgaccgcgggt
tcgggccagaacccggcgcgccaggcgttgatcaaggccggcctgcccgacatggtgccg
ggcatgaccatcaacaaggtgtgcggctcgggcctgaaggccgtgatgctggccgccaac
gccatcgtcgccggggatgccgacatcgtcgtggccggcgggcaggagaacatgtccgcc
gcgccgcacgtgctgcccggctcgcgcgacggtttccgcatgggcgacaccaagctcatc
gactcgatgatcgtggatgggctgtgggacgtctacaaccagtaccacatgggcatcacc
gccgagaatgtcgccaagcagtacggcatcacgcgcgaggcccaggacgcattcgccgtg
gcttcgcagaacaaggcggaagccgcgcagaagtccggtcgcttcaatgacgagatcgtt
cccatcctgattccgcagcgcaagggcgacccgatcgccttcgcgcaggacgagttcgtc
cgccatggcgccacgctggaatcgatgacgggcctgaagccggcattcgacaaagccggc
acggtgacggccgccaatgcctcgggcctcaacgacggcggcgccgccgtggtggtcatg
tcggccgcccgcgccaaggaactgggtctgaccccgctggccaccatccgcgcctacgcc
aatgccggcgtggacccgaaggtgatgggcatgggcccggtgccggcttccaagcgctgc
ctgtcgcgcgccggctggtcggtgggcgacctggacctgatggagatcaacgaggcgttt
gccgcccaggcgctggccgtgcaccagcagatgggctgggataccgccaaggtcaacgtc
aacggcggcgcgattgccatcggtcaccccatcggcgcgtcgggctgccgcatcctggtg
acgctgctgcacgagatgcagaagcgcgacgcgaagaagggcctggcctcgctgtgcatc
ggcggcggcatgggcgtggcgctggcggtcgagcgcccgtga

DBGET integrated database retrieval system