KEGG   Ralstonia solanacearum GMI1000: RSc1646
Entry
RSc1646           CDS       T00071                                 

Gene name
ahpC2
Definition
(GenBank) putative alkyl hydroperoxide reductase (subunit c) oxidoreductase protein
  KO
K24126  lipoyl-dependent peroxiredoxin subunit C [EC:1.11.1.28]
Organism
rso  Ralstonia solanacearum GMI1000
Brite
KEGG Orthology (KO) [BR:rso00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RSc1646 (ahpC2)
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.28  lipoyl-dependent peroxiredoxin
     RSc1646 (ahpC2)
SSDB
Motif
Pfam: AhpC-TSA Redoxin SCO1-SenC Baculo_LEF-2
Other DBs
NCBI-ProteinID: CAD15348
UniProt: Q8XYW0
Position
complement(1769837..1770529)
AA seq 230 aa
MRPGTTDAWPIAAHSPIVAGRVRPPLACLAGALLVCRTPSAAPPQEKPMKTIGDKLEPFK
VIGVKPGFNRHEENGQSAFEDITEASFPGKWKVIYFYPKDFTFVCPTEIVAFARLNQDFE
DRDTVVLGGSTDNEFVKLAWRREHKDLDRLKQWSFADTTGALIDQLGVREHEAGVALRAT
FIVDPDNVIQHVSVNNLNVGRNPDEVLRILDALQTDELCPCNRAVGGATL
NT seq 693 nt   +upstreamnt  +downstreamnt
atgcggccgggcacgacggatgcttggccgattgcagcacattcacccatcgttgccggc
cgcgtccgcccgccgcttgcctgcctggccggcgcgcttcttgtttgcaggacgccgtcc
gctgcgccccctcaggagaagcccatgaagaccattggtgacaagctcgagccgttcaag
gtgatcggtgtcaagccggggttcaaccgccatgaggaaaacggccagtcggcgttcgaa
gacatcactgaggcatcgttcccgggcaagtggaaggtcatctatttctacccgaaggac
ttcaccttcgtgtgcccgaccgagatcgtcgccttcgccaggctgaatcaggacttcgaa
gaccgcgacaccgtcgtgctgggcggctcgaccgacaacgaattcgtcaagctggcctgg
cgccgcgagcacaaggacctcgaccggctgaagcaatggtcgttcgccgacaccaccggc
gcgctgatcgaccagctgggcgtgcgcgagcacgaagccggcgtcgcgctgcgggccacg
ttcatcgtcgatccggacaacgtgatccagcacgtctcggtgaacaacctgaacgtgggc
cgcaacccggatgaagtcctgcgcatcctcgacgccctgcagaccgacgagctgtgcccg
tgcaaccgcgccgtcggcggcgccacgctctga

DBGET integrated database retrieval system