KEGG   Ralstonia solanacearum GMI1000: RSc1818Help
Entry
RSc1818           CDS       T00071                                 

Gene name
metG2
Definition
(GenBank) probable methionyl-trna synthetase protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00450  Selenocompound metabolism
rso00970  Aminoacyl-tRNA biosynthesis
rso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rso00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    RSc1818 (metG2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RSc1818 (metG2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rso01007]
    RSc1818 (metG2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rso03016]
    RSc1818 (metG2)
Enzymes [BR:rso01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     RSc1818 (metG2)
Amino acid related enzymes [BR:rso01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RSc1818 (metG2)
Transfer RNA biogenesis [BR:rso03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RSc1818 (metG2)
 Prokaryotic type
   Other AARSs
    RSc1818 (metG2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1e tRNA-synt_1 zf-RING_7
Motif
Other DBs
NCBI-ProteinID: CAD15520
UniProt: Q8XYE0
Position
1987271..1988761
Genome map
AA seq 496 aa AA seqDB search
MKARKTYVLIPVMPTPNGPLHLGHIAGPFLKMDMLARHLRRNGNTVALVSATDPYETHVL
PRADEQNKPVEQICAENHRAIHRCLQALDIRYDAFIDPLASPYRARLNGITREVLDDLHA
QGRLHARNEPVHISRRTGRMLVGSRIVGTCPCCGVEMGGYHCEGCGMEVSPRDLIAPRAE
PADDTVEVEARASVFVDADLPALQRRMLEARVPADVRRIAERFMHAAGSAVRLSNPGEWG
EIWPNTLATAPSVVFSYTALFMLSVLCGEAAREILALDHNPFDRRSDALIVTSFGFDNTV
PFCVGVETLAQHSRRYRGFDRCLTNFFYTLDGRKFSTSRQHCIWADQAVRELGVASDVLR
YFLAKTSPESGPSDFSRDGFDAFRRAIEPRLAQMKAAVESGIGGDAAVPYADTLARLVAD
MDAAFDVDHFSLRAATRCIDQWLALPWQPAHAAAYVRGFCMLAYPVMPELASTLWSQLGH
EGLPRYLAATELEEAA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctcgcaaaacgtacgtgctcattccggtgatgccgacaccgaatggcccgctg
catcttggccacatcgcgggcccgttcctcaagatggacatgctcgcgcggcatctgcgg
cgcaatggcaacacggtcgcgctggtctccgcgacggatccttatgagacccatgtgctg
ccccgcgccgacgaacagaacaagcccgtcgagcagatctgcgccgaaaaccatcgggcg
attcaccgttgcctgcaggcactcgacattcgctacgatgcttttatcgatccgctcgca
tcgccgtaccgggcacgcctgaacggcattacgcgcgaagtgctcgacgacctgcatgcg
cagggacggctgcacgcgcgcaacgagccggtccacatcagccgccgaaccgggcggatg
ctcgtcggcagccggatcgtcggcacgtgtccgtgttgcggcgtcgaaatgggcggctac
cattgcgaagggtgcggaatggaagtctcgccccgcgacctgattgccccgcgcgccgaa
ccggcggacgacacggttgaggtggaagcgcgggccagtgttttcgtcgacgccgatctc
cccgcgctccagcggcggatgctcgaagcgcgggtgccggccgacgtccgccgcatcgcc
gaacggttcatgcatgcagcgggcagcgcggtgcggctctcgaacccgggcgaatggggc
gagatctggcccaatacgctggcaaccgcaccatcggtggtgttctcctacacggcgctg
ttcatgctatcggtactgtgcggcgaggcggcgcgtgaaatcctcgcgctcgaccacaat
ccgtttgatcggcgctccgacgcgctgatcgtcaccagcttcggattcgacaatacggtg
cctttctgcgtgggcgtggagacgctcgcgcaacacagcaggcgctaccgcggcttcgac
cgctgcttgacgaacttcttctacacgctcgacggccggaagttctcgacgagccgccag
cactgcatctgggccgaccaggcggtacgggagctgggcgtggcctcggacgtgctgcgc
tatttcctggccaagaccagcccggaaagcggaccgagcgatttctcgcgcgacggcttc
gacgcgttccggcgcgcgatcgaaccccgcctggcgcagatgaaagccgcggttgaatcc
ggcattggcggcgatgcagccgttccctatgcggacacattggcgcgacttgtcgcggac
atggacgcggctttcgacgtcgatcatttcagcctgcgtgccgcgacacgctgcattgat
caatggctcgcactcccatggcagccggcgcatgccgccgcgtatgtgcgcggcttttgc
atgctggcctatccggtcatgcccgagctggcctcgaccctgtggagccaactcggccac
gaaggcctgcctcgctatctagccgcgaccgaactggaggaagccgcatga

DBGET integrated database retrieval system