KEGG   Ralstonia solanacearum GMI1000: RSc1888
Entry
RSc1888           CDS       T00071                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rso  Ralstonia solanacearum GMI1000
SSDB
Motif
Pfam: CMD
Other DBs
NCBI-ProteinID: CAD15590
UniProt: Q8XY75
Position
2073392..2073985
AA seq 197 aa
MTEPLRAHGFTNATLEWKAWLDVVDLDRATPGQIAVLEESHPKAKTSDYYRFLVHQPEIL
RQRSAAFNAIMYAPGGLSRAERELASTVVSRVNGCVYCAAVHAQRFEQLAKRNDVIRQVF
EDPHTAGTNARERAIARFSIDLTLRPGDVRAEDLQPLQAAGLTDAEILDLIHAVAIFAWA
NRLMLNLGEPVFPDEAA
NT seq 594 nt   +upstreamnt  +downstreamnt
atgaccgagcccctgcgcgcccacggcttcaccaacgcaaccctggaatggaaagcctgg
ctggacgtggtcgacctcgaccgcgccacgcccgggcaaatcgccgtgctggaagagagc
cacccgaaggccaagacgtcggactactaccgctttctggtgcaccagccggaaatcctg
cgccagcgctcggcggccttcaacgccatcatgtatgcacccggcgggctgtcgcgcgcg
gagcgcgaactggccagcaccgtggtctcgcgcgttaacggctgcgtctactgcgccgcc
gtccatgcgcagcgcttcgagcagctcgccaagcgcaacgacgtcatccggcaggtcttc
gaagacccgcacacagccggcaccaatgcgcgcgaacgggccatcgcccggttctcgatc
gacctcacgctgcgccccggcgacgtgcgcgccgaagacctgcagccgctccaggccgcc
ggcctgaccgatgccgagatcctcgacctgatccacgccgtcgccatcttcgcgtgggcg
aaccggctgatgctgaacctgggcgagccggtgttcccggacgaagccgcgtag

DBGET integrated database retrieval system