KEGG   Ralstonia solanacearum GMI1000: RSc2160Help
Entry
RSc2160           CDS       T00071                                 

Definition
(GenBank) putative xanthosine triphosphate pyrophosphatase protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:rso00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RSc2160
Enzymes [BR:rso01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     RSc2160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: CAD15867
UniProt: Q8XXF4
Position
2342984..2343589
Genome map
AA seq 201 aa AA seqDB search
MRRIVLASNNPGKLAEFNALLAPLGLDVAPQGELGIPEAEEPHATFVENALAKARHASRL
AGLPALADDSGICAHALGGAPGVYSARYAQLAGGPKSDAANNARLVRELAGHADRGAHYV
CVLVYVRHADDPQPIIAEGSWFGEVIDAPRGDGGFGYDPHFLLPALGKTAAELSKAEKNA
VSHRAQALAQLVERLRLFENA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaggatcgtcctggcctccaacaaccccggcaagctggcggagttcaatgcgctg
ctggccccgctcggcctggatgtcgcgccgcagggcgagctgggcattcccgaggcggaa
gagccgcacgcgaccttcgtcgaaaacgccctggccaaggcacggcacgccagccgcctg
gccggcctgcccgcgctggcggacgactccggcatctgcgcgcacgcactgggcggcgcg
ccgggcgtgtattcggcccgctatgcgcaactggccggcgggccgaagtccgacgccgcc
aacaacgcgcgcctggtgcgcgaactggccggacacgccgatcgcggcgcacactatgtc
tgcgtgctggtctacgtgcgccacgcggacgatccgcagccgatcatcgccgaaggcagc
tggttcggcgaagtgatcgacgcgccgcgcggcgacggcggcttcggctacgacccgcac
ttcctgctgcccgcgctcggcaagacggccgccgagctgtccaaggccgagaagaatgcc
gtcagccaccgcgcgcaagcgctcgcgcagctggtcgagcggctgcgcctgttcgagaac
gcctga

DBGET integrated database retrieval system