KEGG   Ralstonia solanacearum GMI1000: RSc2237Help
Entry
RSc2237           CDS       T00071                                 

Gene name
galU1
Definition
(GenBank) probable utp--glucose-1-phosphate uridylyltransferase protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00040  Pentose and glucuronate interconversions
rso00052  Galactose metabolism
rso00500  Starch and sucrose metabolism
rso00520  Amino sugar and nucleotide sugar metabolism
rso01100  Metabolic pathways
rso01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RSc2237 (galU1)
   00052 Galactose metabolism
    RSc2237 (galU1)
   00500 Starch and sucrose metabolism
    RSc2237 (galU1)
   00520 Amino sugar and nucleotide sugar metabolism
    RSc2237 (galU1)
Enzymes [BR:rso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RSc2237 (galU1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: CAD15944
UniProt: Q8XX79
Position
2430215..2431084
Genome map
AA seq 289 aa AA seqDB search
MQRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGRS
KRAIEDHFDKAYELEAELEAKQKTALLEVVRSIKPAHVDCFYVRQPEALGLGHAVLCAEK
LVGNAPFAVILADDLLDGNPPVMKQMVDLYEHYNCSVIGVEEIEREQSRSYGVVDGRPWE
EDGSVIKMSGIVEKPAPEAAPSNLGVVGRYILTPRIFDHIRNIKPGAGGELQLTDAIQSL
LSAEQVLAYRYDGVRYDCGSKLGYLKATVELALKHKEVAEEFREYLASR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcgtcaccaaagccgtcttccccgtcgcgggactgggcacccgcttcctgccc
gccaccaaggccagcccgaaggaaatgctgccggtggtcgacaaacccttgatccagtac
gccgtggaagaagccatggcggccggcatcaccgagatgatcttcgtgaccggccgcagc
aagcgcgccatcgaagaccacttcgacaaggcctacgagctggaagccgaactggaagcc
aagcagaagaccgcgctgctcgaagtggtgcgctcgatcaagccggcgcacgtggactgc
ttctacgtgcgccagccggaagcgctgggcctgggccacgcggtgctgtgcgccgaaaag
ctggtcggcaacgcgcccttcgcggtcatcctggccgatgacctgctggacggcaatccg
ccggtgatgaagcagatggtcgatctgtacgagcactacaactgctcggtgatcggcgtg
gaagagatcgagcgcgagcagagccgctcgtacggcgtggtcgacggccgcccgtgggaa
gaggacggcagcgtgatcaagatgtcgggcatcgtcgagaagccggcaccggaggctgcg
ccgtcgaacctgggcgtggtcggccgctacatcctgacgccgcgcatcttcgaccatatc
cgcaacatcaagccaggcgccggcggcgaactgcagctcacggacgcgatccagtcgctg
ctgtcggccgagcaggtgctggcctaccgctacgacggtgtgcgctacgactgcggcagc
aagctcggctatctgaaggccacggtagagctggcgctcaagcacaaggaagtggccgag
gagttccgcgagtacctggcctcgcgctga

DBGET integrated database retrieval system