KEGG   Ralstonia solanacearum GMI1000: RSc2465Help
Entry
RSc2465           CDS       T00071                                 

Gene name
clpS
Definition
(GenBank) hypothetical atp-dependent clp protease adaptor protein clps.
  KO
K06891  ATP-dependent Clp protease adaptor protein ClpS
Organism
rso  Ralstonia solanacearum GMI1000
Brite
KEGG Orthology (KO) [BR:rso00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    RSc2465 (clpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ClpS
Motif
Other DBs
NCBI-ProteinID: CAD16172
UniProt: Q8XWK9
Position
complement(2674532..2674858)
Genome map
AA seq 108 aa AA seqDB search
MAIRQATTPQHDAGTVLERKEQALKPPAMYKVLLLNDDYTPMEFVVMILQQYFSKDRETA
TQIMLTVHREGRGVCGIYTRDIAATKVELVSTHARQAGHPLQCVMEEA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggcaatccggcaagcgaccactccacaacacgacgcaggcaccgtactggagcggaaa
gagcaagcgctcaaaccgcccgccatgtacaaggtcctgttgctcaacgacgactacacc
ccgatggaattcgtcgtgatgattctgcagcaatatttcagcaaagaccgggagaccgct
acacagatcatgctgactgtgcatcgggaaggtaggggcgtgtgcggtatctacacccgg
gatatcgccgcgacgaaagtggaattggtatcaacccatgcacggcaggcgggccacccc
ctgcagtgcgtgatggaggaagcatga

DBGET integrated database retrieval system