KEGG   Ralstonia solanacearum GMI1000: RSc2578
Entry
RSc2578           CDS       T00071                                 

Gene name
trbL
Definition
(GenBank) putative conjugal transfer trbl transmembrane protein
  KO
K07344  type IV secretion system protein TrbL
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rso00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RSc2578 (trbL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rso02044]
    RSc2578 (trbL)
Secretion system [BR:rso02044]
 Type IV secretion system
  Trb secretion system protein
   RSc2578 (trbL)
SSDB
Motif
Pfam: TrbL
Other DBs
NCBI-ProteinID: CAD16285
UniProt: Q8XW97
Position
complement(2784928..2786301)
AA seq 457 aa
MNDVTIIDRFLDTFSRYIDSGFGLLQGEVAFLTATLIAIDMTIAGLYWAMSHATGQSEDV
IAKLLRKVLYVGAFAYIIGNFNWLSGIVFRSFAGLGITATGSAITMENFLQPGRLAKTGI
DAAAPILDQIGDMAGFPEVFVNLDPIVVLFIAWLVVILCFFVLAVQLFITLIEFKLTTLA
GFVLIPFALWNKTSFLAEKVLGNVVSSGIKVLVLAVIVGIGSGLFAEFQVHPDEPSIDHA
LVVMLASLALLALGIFGPGIATGLVSGAPQLGAGAMAGAAVGAVGTGVAIGAAATGVGGA
VMAGARMAPAAAKLAGSGARAATSAASSAKSAFQAGSAAAGGGAKGAAAGLGNVAKTGAQ
AAGRRAASRVSAAGQKMAGSFRAGWNGADAGAAGSDQAAAGESADSAASAPKQEQPAWAK
QMHRRQQITHAATTAAHTLRGGDGGGSGQGPSLRPDE
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgaatgacgtgaccatcatcgacagattcctcgatacgttctcgcgctatatcgactcc
ggtttcgggctattgcaaggcgaagtcgcgttcctgacggccacgcttatcgccatcgac
atgaccatcgccggcctgtattgggccatgagccatgcgaccggccagagcgaagacgtg
atcgccaagctgctgcgcaaggtgctctacgtcggtgccttcgcctacatcatcggcaac
ttcaactggctctcgggcatcgtgttccggtcgtttgctgggctaggtatcaccgccacc
ggctccgctatcacgatggagaacttcttgcagccgggccgcctggcgaagaccggcatc
gacgcggccgcgccgatcctcgaccagatcggcgacatggccggcttccccgaagtgttc
gtgaaccttgaccccatcgtggtgctgttcatcgcctggctggtggtgatcctctgcttc
ttcgtgctcgcggtacagcttttcatcacgctgatcgagttcaagctgaccacgcttgcc
gggttcgtcctgatcccgtttgcgctctggaacaagacctcgttcctcgcggaaaaggtg
ctcggcaacgtggtttcgtcgggcatcaaggtcttggtgctggccgtcatcgtcggcatc
ggctcgggcctgttcgcggagttccaggttcatcccgacgagccttccatcgaccacgcg
ctggtcgtgatgctggcctcgctcgcgctgctggcgctgggcatcttcggccccggcatc
gccacgggcctcgtgtccggtgcgccgcagctcggcgcgggcgcgatggccggcgctgct
gtcggtgctgtcggcacgggagttgccatcggtgccgccgcgactggcgtaggcggtgcc
gttatggcgggcgcgcgcatggccccggccgccgccaagctggccggcagcggcgcacgc
gccgcgacgtcggcggccagcagcgccaagtccgcattccaggccggttccgccgctgcg
ggcggcggggccaagggcgcggccgctggcctcggcaacgtcgccaagaccggtgcgcag
gccgcaggccgccgcgccgcatcgcgtgtgtccgctgccgggcagaagatggccggttcc
ttccgtgctggctggaacggcgcggatgccggcgctgccggttccgaccaggcggccgca
ggcgaaagcgcggacagcgccgccagcgcaccaaagcaggagcaacccgcctgggccaag
cagatgcaccgccgccaacagatcacccacgccgcgaccaccgctgcccacacgctgcgc
ggtggcgatggtggcggctcggggcaaggcccgagcctgcgccccgatgagtga

DBGET integrated database retrieval system