KEGG   Ralstonia solanacearum GMI1000: RSc2650Help
Entry
RSc2650           CDS       T00071                                 

Gene name
ppnK
Definition
(GenBank) putative inorganic polyphosphate/atp-nad kinase (poly(p)/atp nad kinase) protein
  KO
K00858  NAD+ kinase [EC:2.7.1.23]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00760  Nicotinate and nicotinamide metabolism
rso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rso00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    RSc2650 (ppnK)
Enzymes [BR:rso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.23  NAD+ kinase
     RSc2650 (ppnK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_kinase
Motif
Other DBs
NCBI-ProteinID: CAD16357
UniProt: Q8XW25
Position
2851770..2852678
Genome map
AA seq 302 aa AA seqDB search
MTSRANATSPFKTVALVGRYSAANIAAPLLELASCIAARGHDIVFERETALNIGVQDYPA
LPPDEMARHADVAVVLGGDGTLLGIGRHLAGASVPVIGVNHGRLGFMTDIPFEDVHNVLP
DMLAGQYEAETRSLLQAQVVRDDETIFSALAFNDVVVNRSGFSGMVELAVSVDGFFMYNQ
RSDGLIVSTPTGSTAYALSAGGPILHPALSGLVLVPIAPHALSNRPIVIPHDAEVVIQVT
SGRDASVNFDMQSLTSLLPGDRIVVRRSERTVRLLHPVGYNYYATLRKKLHWHEYPTEDN
RL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcccgcgcgaacgccacttcgcccttcaagaccgtcgcgctggtcggccgctat
tcggccgccaatatcgccgctccgctgctggaactggcgtcgtgcatcgccgcgcgcggc
cacgatatcgtcttcgaacgggaaaccgccctgaacatcggggtccaggactaccccgcc
ctgccgcccgacgagatggcgcgccatgccgacgtggccgtggtgctgggcggcgacgga
acgctgctcggcatcgggcgccacctggccggcgcgtcggtgccggtcatcggggtcaac
cacggccggctcggcttcatgacggacatcccgttcgaagacgtgcacaacgtgctgccc
gacatgctggccggccagtacgaagccgaaacccgctcgctgctgcaggcccaagtggtg
cgcgatgacgagaccatcttctccgccctggccttcaacgacgtggtggtcaaccgctcg
ggcttttccggcatggtcgagctggccgtctcggtggacggcttcttcatgtacaaccag
cgctcggatggcctgatcgtgtccacgcccaccgggtcgacggcctatgcgctgtcggcg
ggcgggccgatcctgcacccggcgctgtcgggcctggtgctggtgccgatcgcgccgcac
gcgctgtccaaccggcccatcgtcattccgcacgacgccgaggtcgtcatccaggtcacc
agcgggcgcgacgccagcgtcaacttcgacatgcagtcgctcacgtcgctgctgccgggc
gaccgcatcgtggtgcgccgctccgaacgcaccgtgcggctgctgcatccggtcggctac
aactactacgccacgctgcgcaagaagctgcactggcacgagtacccgaccgaagacaac
cggctgtaa

DBGET integrated database retrieval system