KEGG   Ralstonia solanacearum GMI1000: RSc2846Help
Entry
RSc2846           CDS       T00071                                 

Gene name
murD
Definition
(GenBank) probable udp-n-acetylmuramoylalanine--d-glutamate ligase (udp-n-acetylmuramoyl-l-alanyl-d-glutamate synthetase) (d-glutamic acid-adding enzyme) protein
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00471  D-Glutamine and D-glutamate metabolism
rso00550  Peptidoglycan biosynthesis
rso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rso00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    RSc2846 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RSc2846 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rso01011]
    RSc2846 (murD)
Enzymes [BR:rso01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     RSc2846 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:rso01011]
 Precursor biosynthesis
  Amino acid ligase
   RSc2846 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: CAD16553
UniProt: Q8XVI5
Position
complement(3061730..3063370)
Genome map
AA seq 546 aa AA seqDB search
MTEPIRAPEDTLPTPPAAGDALIAGAIAATVDSAEPMPAAETAQAPRMFGDLASPFVLVL
GLGESGLAMARWCARHGARARVADTREAPANLPALRAHVPDAEFIGGPFAPSLLEGVALV
AISPGLSPLDAAVAALLDGARERAVPVWGEIELFARALAGLKLAQGYAPRVLAITGTNGK
TTTTALAGALVQRAGKTVGVAGNISPSALDKLTECVDAGTLPDVWVLELSSFQLETTHTL
DADAATILNITQDHLDWHGSMAAYAAAKGRIFGAGTVRVLNRQDADVMAFAGKRGGDVTF
GTDEPATPEALGLLRDGGIPWIVLAEADDDDLPKPARRKKGDTTPAAPVPVRLKRLMPAD
ALRIRGLHNATNAMAALALCRAIGLPASALLHGLRDYAGEPHRVELIAAFDDIEFFDDSK
GTNVGATVAALSGLSKRVVLIAGGDGKGQDFSPLAAPVAQYARAVVLIGRDAPRIRAALA
DSGVELVEAATLEAAVQEAAARAQAGDAVLLSPACASFDMFRNYEHRAQVFHEAVAALAA
DRGVML
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaccgatccgcgctcccgaagacacgctgccgacgccgccggccgccggggac
gcgctcatcgccggcgccattgctgcgaccgtcgattcggccgagccgatgcccgccgcc
gaaaccgcgcaggcgccgcgcatgttcggcgacctggcgtcgccgttcgtgctggtactg
ggcctgggcgagtccggcctggccatggcgcgctggtgcgcgcgccatggcgcgcgcgcg
cgcgtggccgatacgcgcgaggcgcccgccaacctgccggcgctgcgcgcgcatgtgccg
gatgccgaattcatcggcgggccgttcgctccgtcgctgctggaaggcgtggcgctggtg
gcgatcagccccggcctgtcgccgctggatgctgccgttgccgcgctgctggacggcgca
cgcgagcgcgcggtgccggtgtggggcgagatcgaactgttcgcgcgcgcgctggccggc
ctgaagctggcgcagggctatgcgccccgcgtcctggccatcaccggcaccaacggcaag
accaccaccacggcgctggcgggtgccctggtccagcgcgccggcaagaccgtcggcgtg
gcgggcaacatcagcccctcggcgctggacaagctgaccgagtgcgtcgacgccggcacg
ttgccggacgtgtgggtgctggagctctccagcttccagctggaaaccacgcacacgctc
gacgccgacgccgcgaccatcctcaacatcacgcaggaccacctggactggcacggctcg
atggccgcctacgccgccgccaagggccgcattttcggtgccggcacggtgcgcgtgctg
aaccggcaggacgccgacgtgatggccttcgccggcaagcgtggcggcgatgtcacgttc
ggcaccgacgaaccggccacgcccgaagcgctcggcctgctgcgcgacggcggcatcccg
tggatcgtgctggccgaagccgacgatgacgatctgccgaagcccgcgcgccgcaagaag
ggcgacaccacgcccgccgcgccggtgccggtgcggctcaagcgcctgatgccggccgat
gccctgcgcatccgcggcctgcacaacgccaccaatgcgatggccgcgctggcgctgtgc
cgcgcgatcggcctgccggcgagcgccttgctgcacggcctgcgcgactacgccggcgag
ccgcaccgcgtcgaactgatcgccgccttcgacgacatcgaattcttcgacgacagcaag
ggcaccaacgtcggcgccacggtcgcggcgctgtcgggcctgtccaagcgcgtggtgctc
atcgccggcggcgacggcaaggggcaggacttctcgccgctggccgcgccggtggcgcag
tacgcgcgcgccgtggtgctgatcggccgcgatgcaccgcggatccgcgccgcgctggcg
gacagcggcgtcgaactggtggaggccgccacgctggaggccgccgtgcaggaagcggcc
gcgcgcgcgcaggcaggggatgccgtgctgctgtcgccggcctgcgcgagcttcgacatg
ttccgcaactacgaacaccgcgcgcaggtgttccacgaagccgtggccgcgctggcggcc
gatcggggagtgatgctatga

DBGET integrated database retrieval system