KEGG   Ralstonia solanacearum GMI1000: RSc2878Help
Entry
RSc2878           CDS       T00071                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06195  ApaG protein
Organism
rso  Ralstonia solanacearum GMI1000
Brite
KEGG Orthology (KO) [BR:rso00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    RSc2878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: CAD16585
UniProt: Q8XVF3
Position
complement(3106591..3106965)
Genome map
AA seq 124 aa AA seqDB search
MSRYELTVQVRTRYLPEQSEPSQDQYAFAYTITIRNTGEVPSQLVSRHWVITDAESHVQE
VAGLGVVGHQPLLPPGESFEYTSWATIKTPVGTMRGEYFCVAEDGHRFEAPIPEFALAMP
RMLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgctacgaactcaccgtccaggtccggacgcgctacctgcctgagcaatccgag
ccctcgcaggaccagtacgcctttgcctacaccatcactatccgcaatacgggcgaggta
ccgagccagctggtctcgcggcactgggtcatcaccgacgcggagagccacgtgcaggag
gtcgccggcctcggcgtggtcggccaccagccgctgctgccgccgggcgaatcgttcgag
tacaccagctgggcgaccatcaagacgccggtgggcaccatgcgcggcgaatacttctgc
gtggccgaggacggccatcgcttcgaggcgccgattcccgagtttgcgctggcgatgccg
cgcatgctgcattga

DBGET integrated database retrieval system