KEGG   Ralstonia solanacearum GMI1000: RSc3130Help
Entry
RSc3130           CDS       T00071                                 

Gene name
adhA
Definition
(GenBank) putative propanol-preferring alcohol dehydrogenase oxidoreductase protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00010  Glycolysis / Gluconeogenesis
rso00071  Fatty acid degradation
rso00350  Tyrosine metabolism
rso00625  Chloroalkane and chloroalkene degradation
rso00626  Naphthalene degradation
rso01100  Metabolic pathways
rso01110  Biosynthesis of secondary metabolites
rso01120  Microbial metabolism in diverse environments
rso01130  Biosynthesis of antibiotics
rso01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSc3130 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    RSc3130 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    RSc3130 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RSc3130 (adhA)
   00626 Naphthalene degradation
    RSc3130 (adhA)
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RSc3130 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C adh_short TrkA_N Methyltransf_25 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CAD16839
UniProt: Q8XUQ6
Position
3376654..3377679
Genome map
AA seq 341 aa AA seqDB search
MARSMKAAVVHAFGEPLRIEDVPIPTPGRGQILVNIRASGVCHTDLHAADGDWPVKPRLP
FIPGHEGVGFVAAVGEGVTAVKEGDRVGVPWLYTACGHCEHCLGGWETLCHDQQNTGYSV
NGGYAEYVLADPNYVGHLPAQVGFEEIAPILCAGVTVYKGIRMTDTRPGQWIAISGIGGL
GHVAVQYAVAMGLHVVAVDVAPEKLALARELGARLSVDASQQDPAAVIQKEVGGVHGVLV
TAVSRSAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
QFAAEGQVRAHIHRDRLDNINQVLADLKAGKVDGRIVLSLD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggccaggtcgatgaaagccgctgtcgtgcacgcgttcggcgaaccgctgcgcatcgag
gacgtcccgatcccgacgccgggccgcggacagatcctcgtcaacatccgggcttccggg
gtctgccacaccgacctgcacgccgccgacggcgactggccggtcaagccgcgcctgccg
ttcatccccgggcacgagggcgtgggcttcgtggcggcggtgggcgaaggcgtcaccgcc
gtcaaggaaggcgaccgcgtgggcgtgccctggctctacaccgcctgcggccactgcgaa
cactgcctgggcggctgggaaaccctgtgccacgaccagcagaacactggctactccgtc
aacggcggctacgccgaatacgtgctggccgaccccaactatgtcggccacctgccggcg
caggtcggcttcgaggagatcgcacccatcctgtgcgcgggcgtgacggtctacaagggc
atccgcatgaccgacacccgccccggccagtggatcgccatctcgggcatcggcgggctg
gggcatgtggcggtgcagtatgccgtcgccatggggctgcacgtggtggcggtggatgtc
gcccccgagaagctggcgctggcgcgcgaactgggcgcccggctgagcgtcgatgcctcg
cagcaggacccggccgctgtcatccagaaggaggtgggcggcgtgcacggcgtgctggtg
acggcggtctcgcgcagcgccttcgcccaggccctgggcatggtgcgacgcggcggcacc
gtctcgctcaacggattgccgccgggcgactttccgctgccgatcttctcgaccgtgctc
aacggcatcacggtgcgcggctccatcgtcggcacgcggcgcgatctgcaggagtcgctg
cagttcgccgccgaggggcaggtgcgcgctcacatccatcgcgaccggctcgacaacatc
aaccaggtcctcgccgacctgaaagccggcaaggtggacggccgcatcgtcctctcgctg
gactga

DBGET integrated database retrieval system