KEGG   Ralstonia solanacearum GMI1000: RSc3301Help
Entry
RSc3301           CDS       T00071                                 

Gene name
putA
Definition
(GenBank) probable bifunctional: proline dehydrogenase and proline oxidase delta-1-pyrroline-5-carboxylate dehydrogenase transcription regulator protein
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00250  Alanine, aspartate and glutamate metabolism
rso00330  Arginine and proline metabolism
rso01100  Metabolic pathways
rso01110  Biosynthesis of secondary metabolites
rso01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rso00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RSc3301 (putA)
   00330 Arginine and proline metabolism
    RSc3301 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rso03000]
    RSc3301 (putA)
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     RSc3301 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     RSc3301 (putA)
Transcription factors [BR:rso03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    RSc3301 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: CAD17089
UniProt: Q8XU92
Position
complement(3558770..3562747)
Genome map
AA seq 1325 aa AA seqDB search
MATTTLGVKLDDASRERLKRAAQSIDRTPHWLIKQAIFTYLDQVERGQLPNDAGGPAADG
LPSAAAAVADMADADGTEAVVQPFLEFAQSVQPQSVLRAAITAAYRRPETEAIPMLLEQA
RLPGALASEAKQLARDLAGKLRTQKVGTGREGLVQGLIQEFSLSSQEGVALMCLAEALLR
IPDKATRDALIRDKISSGNWQSHLGQSPSLFVNAATWGLLLTGKLVATHNEAGLSKALTR
IIGKRGEPLIRKGVDMAMRLMGEQFVTGETISEALANARKYEAEGFRYSYDMLGEAAMTE
EDAQRYLASYEQAIRAIGQASGGRGIYEGPGISIKLSALHPRYSRAQYDRAINELYPRVK
GLAMLAREYDIGINIDAEEADRLELSLDLLERLCFAPELAGWNGIGFVVQGYQKRCPFVL
DYLIDLARRSKHRLMIRLVKGAYWDSEIKRAQVDGLEGYPVYTRKVYTDVSYLACARKLL
AAPDVVFPQFATHNAHTLAAIYHMAGQNYYPGQYEFQCLHGMGEPLYEQVVGNKPGKLNR
PCRIYAPVGTHETLLAYLVRRLLENGANTSFVNRIADESIPLDELVADPVAVVENMHAEE
GALGLPHPKIPLPRHLYGDVRANSAGIDLANEHRLASLSSALLAGTSSVWAAEPTIGDAP
YTGGTPQPVRNPSDLRDVVGHVTEATEADVDAALSAAAAAAPIWQATLPEARAALLDRAA
DLMEGEMQHLMGLIIREAGKTLSNAIAEVREAVDFLRYYAAQVRGGFSNDTHRPLGPVVC
ISPWNFPLAIFTGQVSAALAAGNPVLAKPAEQTPLIAAQAVRILREAGVPAGAVQLLPGR
GETVGAALVKDARTKGVMFTGSTEVARILQRTLAGRLDANGAPIPLIAETGGQNAMIVDS
SALAEQVVADVLSSAFDSAGQRCSALRVLCLQDDVADRVLAMLKGGMAELAMGNPDRLST
DVGPVIDAEARDNIVGHIEGMRAKGRRVHQAPAPAACAHGTFVPPTVIELDSLSDLTREI
FGPVLHVVRWKRTADNAGLTRLIEQINGTGYGLTLGIHTRIDETIAHIVERARVGNLYVN
RNIVGAVVGVQPFGGEGLSGTGPKAGGSLYLLRLLSTCPQDAMRTALELTAGAGTDVETE
ERRALLAPFDALRDWARRQSPGLAALCDRLAAATATGAVLTLPGPTGERNTYMLLPRDAV
LCVAADPADWLRQLAAVLAVGSEAVVQENPAIAEVLRTLPSAVQSRVRTVASLEDAAFDA
VLHHGDSDHLRALCEGLARRAGPIVGVQGLPHGGQGLALERLLIERSLSVNTAAAGGNAS
LMTIG
NT seq 3978 nt NT seq  +upstreamnt  +downstreamnt
atggctacgaccaccctcggggtcaagctggacgatgcttcgcgcgaacgcctcaagcgc
gcagcccagtccattgaccgcacaccgcactggctgatcaagcaggcgatcttcacctat
ctggaccaagtggagcgggggcagctgccgaatgatgcgggcggtccggcggcggatggc
ctcccgtccgccgccgcagccgtcgcggacatggccgatgccgatggcaccgaggccgtg
gtgcaacccttcctcgaattcgcgcagagcgtgcagccgcagtcggtgctgcgcgccgcc
atcacggccgcctaccgccggccggaaaccgaggcgattccgatgctgctggagcaggcc
cgcctgccgggcgcgctggcctccgaggccaagcagctcgcccgcgaccttgccggcaag
ctccgtacgcaaaaggtcggcaccggccgcgaaggtctggtgcaaggtctgattcaagag
ttctccctgtcgagccaggagggcgtggcgctgatgtgcctggccgaggcactgctgcgc
attcccgacaaggccacgcgcgatgcgctgatccgcgacaagatcagcagcggcaactgg
cagtcgcatctgggccagagcccgtcgttgttcgtcaacgccgccacctggggcctgctg
ctgacgggcaagctggtggccacgcacaacgaggccggactgtcgaaggcgctcacgcgc
atcatcggcaagcgcggcgagccgctgatccgcaagggcgtcgacatggcgatgcgcctg
atgggcgagcagttcgtcaccggcgagaccatttccgaagcgctggccaacgcccgcaag
tacgaggccgaaggcttccgctactcctacgacatgctcggcgaagccgccatgacggaa
gaggatgcccagcgctacctcgcgtcgtacgagcaggccatccgcgcgatcggccaggct
tcgggcgggcgcggcatctatgaggggccgggcatctcgatcaagctgtcggcgctgcac
ccgcgctacagccgcgcccagtacgaccgcgccatcaatgagctgtatccgcgcgtgaag
ggcctggccatgctggcccgcgagtacgacatcggcatcaacatcgatgcggaagaagcc
gaccgcctggagctgtcgctcgatctgctcgagcgcttgtgcttcgcgcccgagctggcc
ggctggaacggcatcggcttcgtggtgcagggctaccagaagcgctgcccgttcgtgctc
gactacctcatcgacctggcgcgccgcagcaagcaccgcctgatgattcgcctggtcaag
ggcgcctactgggacagcgagatcaagcgcgcccaggtcgacggcctggagggctatccg
gtctatacgcgcaaggtctacaccgacgtgtcgtacctggcctgcgcgcgcaagctgctg
gccgcgcccgatgtcgtgtttccgcagttcgccacgcacaacgcccatacgctggcggcc
atctatcacatggccgggcagaactattaccccggccagtacgaattccagtgcctgcac
ggcatgggcgagccgctgtacgagcaggtggtcggcaacaagccgggcaagctcaaccgg
ccgtgccgcatctacgcgccggtcggcacgcacgagacgctgctggcctacctggtgcgc
cgcctgctggagaacggcgccaacacctcgttcgtcaaccgcatcgcggacgagtcgatt
ccgctggacgaactcgtcgccgatccggtggcggtggtggagaacatgcacgccgaggaa
ggcgcgctcggcctgccgcatccgaaaattccgttgccgcgccatctctatggtgatgtg
cgtgccaattcggcagggatcgacctggcgaacgagcatcggctggcgtcgttgtcgtct
gcgctgctggccggtaccagctcggtctgggccgctgaaccgaccatcggcgatgcgcca
tacaccggtggcacgccgcaaccggtgcgcaacccgtcggacctgcgtgacgtggtcggc
cacgtgaccgaagccactgaagccgacgtcgatgccgcgctgtcggccgccgccgccgcc
gccccgatctggcaagccacgctgcccgaagcgcgtgccgcgctgctcgatcgcgccgcc
gacctgatggaaggcgagatgcagcacctgatgggcctgatcatccgcgaggcgggcaag
acgctgtccaacgcgatcgccgaagtgcgcgaggcggtggacttcctgcgctactacgcg
gcgcaggtgcgtggcgggttctccaacgacacgcaccgcccgctgggcccggtggtctgc
atcagcccgtggaacttcccgctggcgatcttcaccggccaggtgagcgcggcgctggcc
gccggcaacccggtgctggccaagcccgccgagcagaccccgctgatcgccgcacaggcc
gtgcgcatcctgcgcgaagccggcgtgccggccggcgcggtgcagctgctgccgggccgc
ggcgagaccgtcggggccgcactggtgaaggatgcgcgcaccaagggcgtgatgttcacc
ggctcgaccgaggtggcgcgcatcctgcagcgcacgctggccggccgcctggatgccaac
ggtgcaccgatcccgctgatcgccgagaccggcggccagaacgcgatgatcgtcgattcg
tcggcgctggccgagcaggtggtggccgatgtgctgtcgtccgccttcgattccgccggg
cagcgctgctcggccctgcgcgtgctgtgcctgcaggacgacgtggccgaccgcgtgctg
gcgatgctcaagggcggcatggccgagctggcgatgggcaatcccgatcgcctgtccacc
gacgtcggcccggtgatcgacgccgaggcgcgcgacaacatcgtcggccatatcgaaggg
atgcgcgccaagggccggcgcgtgcaccaggcgcccgcgccggctgcctgcgcccacggc
accttcgtgccgccgacggtgatcgaactcgacagcctgtcggacctgacgcgcgagatc
ttcgggccggtgctgcacgtggtccgctggaagcgcacagccgacaacgccggcctcacc
cggctcatcgagcagatcaacggcacgggctacggcctgacgctgggcatccacacccgc
atcgacgagaccattgcgcacatcgtcgagcgggcgcgggtgggcaacctgtacgtgaac
cgcaatatcgtcggcgcggtggtcggcgtgcagccgttcggcggcgagggcctgtcgggc
accggcccgaaggcgggcggctcgctgtatctgctgcgcctgctgtcgacctgcccgcag
gacgcgatgcgcacggcgctggagttgaccgcgggcgccggcaccgacgtcgagaccgag
gagcgccgcgcgctgctggcgccgttcgacgcgctgcgtgactgggcgcgccggcagtcg
cccgggctggccgcgctgtgcgaccgcctggcggcggccacggccaccggcgcggttctg
acgctgccgggcccgaccggcgagcgcaacacctatatgctgctgccgcgcgacgcggtg
ctgtgcgtggcggccgatccggccgactggctgcgtcagctggcggccgtgctggcggtg
ggcagcgaggcggtcgtgcaggaaaaccctgccatcgccgaggtgctgcgtacgctgccg
tcggcagtacaatcgcgcgtccggacggtggcgtcgctggaagacgcggcgttcgacgcg
gtgctgcaccacggcgattcggatcacctgcgcgccctgtgcgaagggctggcgcgccgt
gccggtccgatcgtcggcgtgcagggcttgccgcacggcggacaggggctggcgctggag
cgcctgctgatcgagcgttcgctgtcggtcaacacggccgcggcgggtggcaacgccagc
ctgatgaccatcggctga

DBGET integrated database retrieval system