KEGG   Ralstonia solanacearum GMI1000: RSc3356Help
Entry
RSc3356           CDS       T00071                                 

Gene name
phhB
Definition
(GenBank) putative pterin-4-alpha-carbinolamine dehydratase (phs)(4-alpha-hydroxy-tetrahydropterin dehydratase) (pterin carbinolamine dehydratase) (pcd) protein
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00790  Folate biosynthesis
rso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rso00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RSc3356 (phhB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rso04147]
    RSc3356 (phhB)
Enzymes [BR:rso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     RSc3356 (phhB)
Exosome [BR:rso04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RSc3356 (phhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: CAD17144
UniProt: Q8XU38
Position
3616528..3616833
Genome map
AA seq 101 aa AA seqDB search
MMPTLNDEQRKALFAELPGWSLQNDRDAIHKRFTFTDFNAAFGFMTRVALKAEQVNHHPE
WFNVWNRVDITLSTHDANGLTHRDADLARFIEQAAQLTGAK
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgactctcaatgacgaacaacgcaaggccctgtttgccgaactgccgggctgg
tcgctgcagaacgaccgcgatgcgatccacaagcgcttcaccttcaccgacttcaacgcc
gcgttcggcttcatgacgcgcgtggcgctcaaggccgagcaggtgaatcaccatccggag
tggttcaatgtgtggaatcgcgtggacatcacgctgtccacgcacgatgccaacggcctc
acgcaccgcgatgcggatctcgcgcgcttcatcgagcaggccgcgcagctgaccggcgcc
aagtaa

DBGET integrated database retrieval system