KEGG   Ralstonia solanacearum GMI1000: RSc3383Help
Entry
RSc3383           CDS       T00071                                 

Gene name
kdpB
Definition
(GenBank) probable potassium-transporting atpase b chain (potassium-translocating atpase b chain) (atp phosphohydrolase [potassium-transporting] b chain) (potassium binding and translocating subunit b). transmembrane protein
  KO
K01547  potassium-transporting ATPase ATP-binding subunit [EC:7.2.2.6]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rso00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RSc3383 (kdpB)
Enzymes [BR:rso01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.6  P-type K+ transporter
     RSc3383 (kdpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase E1-E2_ATPase Hydrolase_3 HAD CBS
Motif
Other DBs
NCBI-ProteinID: CAD16880
UniProt: Q8XU11
Position
3643640..3645874
Genome map
AA seq 744 aa AA seqDB search
MALRYPESDPVVRTVKHRLDSTDAAAHAAAPARTTTHPGAHPPLSAKDVRRLSMFAPALV
RPAIVDSFRKLSPRAQAKNPVMFVVYIGSILTTLLWVMALRGQAEAPAGFILAVSVWLWF
TVLFANVAEALAEGRSKQQAASLRGIKTTVQAKVLADPQRRDRVQPRAATALRRGDIVLI
EAGDMVPGDGEVIEGVASVDESAITGESAPVIRESGGDFSSVTGGTRVLSDWIVARITAN
PGESFLDRMISMVEGAKRQKTPNELALTILLVSLTIILLLATVTLLPYSIFSVEVMKAAG
VTSSPITITVLVALLVCLIPTTIGGLLSAIGVAGMSRMMQANVIATSGRAVEAAGDVDVL
LLDKTGTITHGNRQASRFIPAPGVTVKALAEAAWLSSLADETPEGRSIVTLARQLGEAAV
DEAALARSQPVFVPFSAQTRMSGINVALGDAAHQIRKGAADAIRTHVTVLAGRFPEAVLA
AVEDVARKGGTPLVVSDNDRVMGVVELKDIVKAGIRERFAELRQMGIKTVMITGDNRLTA
ASIAAEAGVDDFIAEAAPETKLALIREQQAQGRLVAMTGDGTNDAPALAQADVAVAMNSG
TQAAKEAGNMVDLDSSPTKLIQIVEIGKQMLMTRGSLTTFSIANDVAKYFAIIPAAFATT
YPQLAALNVMRLATPASAVMSAVIFNALIIVFLIPLALKGVKYRPLGAAALLRRNLWIYG
LGGLLLPFPGIKLIDMFLAAMGWV
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggctctccgctatcctgaatccgatccggtggtgcgcaccgtcaagcaccgcctggac
agcacggacgctgccgcccatgccgccgcgcccgcccgcaccaccacgcaccccggcgcg
caccctccgctgagcgccaaggacgtgcgccggctgtcgatgttcgcgccggcactggtc
aggcccgccatcgtcgacagtttccgcaagctgtcgccgcgcgcgcaggccaagaacccg
gtgatgttcgtcgtctatatcggcagcatcctgaccaccctgctgtgggtgatggcgctg
cgcggccaggccgaggcgccggcgggcttcatcctcgccgtgtcggtgtggctgtggttc
accgtgctgttcgccaacgttgccgaggcgctggccgagggccgcagcaagcagcaggcc
gcctcgctgcgcggcatcaagaccaccgtgcaggccaaggtgctggccgatccccagcgg
cgcgaccgcgtgcagccgcgcgcggccaccgcgctgcgccgtggcgacatcgtcctcatc
gaagccggcgacatggtgcccggcgacggcgaggtcatcgaaggcgtggcctcggtggac
gagagcgccatcaccggggaatccgcgccggtgatccgcgagtccggcggcgatttctcg
tcggtcaccggcggcacgcgcgtgctgtcggactggatcgtggcgcgcatcaccgccaac
ccgggcgagagcttcctcgaccgcatgatctcgatggtggaaggcgccaagcggcagaag
acgcccaacgagctggcgctgaccatcctgctggtgagcctgaccatcatcctgctgctg
gcgaccgtcacgctgctgccgtactcgatcttctcggtggaggtgatgaaggccgcgggc
gtgacaagttcgccgatcaccatcaccgtgctggtggcgctgctggtgtgcctgatcccg
accaccatcggcgggctgctgtcggccatcggcgtggccggcatgagccgcatgatgcag
gccaacgtgatcgccacctcgggccgcgcggtggaagccgccggcgacgtcgacgtgctg
ctgctcgacaagaccggcaccatcacgcacggcaaccgccaggcctcgcgcttcatcccc
gcgccgggcgtgacggtcaaggcgctggccgaggccgcgtggctgtcgtcgctggccgac
gagacgcccgagggccgcagcatcgtcacgctggcgcgccagctgggcgaggccgccgtc
gacgaggcggcgctggcgcggtcgcagccggtgttcgtgcccttctccgcgcagacgcgc
atgagcggcatcaacgtggccctgggcgacgcagcgcaccagatccgcaagggcgccgcc
gatgccatccgcacgcacgtgacggtgctggccggccggtttcccgaggccgtgctggcc
gccgtggaagacgtggcgcgcaagggcggcacgccactggtggtgtccgacaacgaccgc
gtgatgggcgtggtggaactgaaggacatcgtcaaggccggcattcgcgagcgctttgcc
gagctgcgccagatgggcatcaagacggtgatgatcaccggcgacaaccgcctgaccgcc
gcctccatcgcggccgaagcgggcgtcgacgacttcatcgccgaggccgcgcccgagacc
aagctcgcgctgatccgcgaacagcaggcgcagggccgcctcgtcgccatgaccggcgac
ggcaccaacgacgcgcccgcgctcgcccaggccgatgtggcggtcgccatgaacagcggc
acgcaggcggccaaggaggccggcaacatggtcgacctggattccagcccgaccaagctg
atccagatcgtggagatcggcaagcagatgctgatgacgcgcggctcgctcaccacgttc
tccatcgccaacgatgtggccaagtatttcgccatcatcccggcggcgttcgcgaccacg
tatccgcaactggccgcgctcaacgtgatgcgcctggccacgcccgcgtcggccgtgatg
agcgcggtgatcttcaacgcgctgatcatcgtgttcctgatcccgctggcgctcaagggc
gtgaagtaccgcccgctcggcgccgccgcgctgctgcgccgcaatctctggatctacggc
ctgggcggcctgctgctgcccttccccggcatcaagctgatcgacatgttcctggccgcg
atgggctgggtctga

DBGET integrated database retrieval system