KEGG   Ralstonia solanacearum GMI1000: RSc3442Help
Entry
RSc3442           CDS       T00071                                 

Gene name
dnaA
Definition
(GenBank) probable chromosomal replication initiator protein dnaa.
  KO
K02313  chromosomal replication initiator protein
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rso00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RSc3442 (dnaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rso03032]
    RSc3442 (dnaA)
   03036 Chromosome and associated proteins [BR:rso03036]
    RSc3442 (dnaA)
DNA replication proteins [BR:rso03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    RSc3442 (dnaA)
Chromosome and associated proteins [BR:rso03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    RSc3442 (dnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 AAA AFG1_ATPase ATPase_2 TsaE RNA_helicase
Motif
Other DBs
NCBI-ProteinID: CAD16939
UniProt: Q8XTV4
Position
complement(3714708..3716276)
Genome map
AA seq 522 aa AA seqDB search
MQDFWHAASAQLESELTPQQFKTWIKPLTPLSFDEQACMLRIAAPNRFKLDWVKSQFSGR
IQSLACDYWEMQVDVQFVLDPTAGQRQAAMQPALAPMPMQPLAAQTMQAQAVPREAPARP
TMAPYRETPMATAAHAAADIDVPVMDAAEASTQSYRVPAPAAPAVMGGLSAPPAAPVDDT
VHERSRLNPILTFDNLVTGKANQLARAAAVQVANNPGKSYNPLYLYGGVGLGKTHLIHAI
GNFMLMENPRARIRYIHAEQYVSDVVKAYQRKAFDDFKRYYHSLDLLLIDDIQFFSGKNR
TQEEFFYAFEALIANRAQVIITSDTYPKEITGIDDRLISRFDSGLTVAIEPPELEMRVAI
LMKKAQAENVTVPEEVAFFVAKHLRSNVRELEGALRKILAYSNFHGKEITIEVTREALKD
LLTVQNRQISVENIQKTCADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEI
GELFGGRDHTTVLHAVRKIADERSKDAQLNHELHVLEQTLKG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatttttggcatgcggcgtccgcccagctcgagagcgagctgactccgcaacaa
ttcaagacgtggatcaagccgctgacgccgctgtcattcgacgagcaggcgtgcatgctg
cggattgccgcgcctaaccgtttcaagctcgactgggtcaagagccagttttcgggccgc
attcagtcgctcgcgtgcgactactgggagatgcaggtcgacgtgcagttcgtgctcgac
ccgaccgccggccagcgccaggccgccatgcagccggcactggccccgatgccgatgcag
ccgctggctgcgcaaacgatgcaggcccaggctgtgccgcgcgaagcgccggcccgcccc
acaatggcgccctaccgcgaaaccccgatggccacggccgcccatgcggcggccgacatc
gacgtgcccgtcatggacgccgccgaggccagcacccagtcgtaccgcgtgccggcaccg
gccgcacccgccgtgatgggtggcctgagcgcaccgcccgccgccccggtggatgacacc
gtgcacgagcgctcacggctgaaccccatcctcaccttcgacaacctcgtcaccggcaag
gccaaccagttggcgcgcgcggccgccgtgcaggtcgccaacaacccgggcaagtcgtac
aacccgctgtacctgtacggcggggtggggctgggcaagacccacttgatccatgccatc
ggcaacttcatgctgatggagaacccgcgcgcgcgtatccgctacatccacgcagaacag
tacgtttccgacgtagtgaaggcttaccagcgcaaggcgttcgacgacttcaagcgctac
taccactcgctggacctgctgctgatcgacgacatccagttcttctcgggcaagaaccgc
acgcaggaagaattcttctatgcgttcgaggcgctgatcgccaaccgcgcgcaggtcatc
atcaccagcgacacgtacccgaaggagatcaccggcatcgatgaccggctgatctcgcgc
ttcgactccggcctgacggtggccatcgagccgcccgagctggagatgcgcgtcgccatc
ctgatgaagaaggcgcaggccgagaacgtgacggtgccggaggaggtggccttcttcgtg
gccaagcacctgcgctcgaacgtgcgcgagctggaaggcgcgctgcgcaagatcctggcg
tactcgaacttccacggcaaggagatcaccatcgaggtcacgcgcgaggcgctcaaggat
ctgctcacggtgcagaaccggcagatctcggtggagaacatccagaagacctgcgcggac
ttctacaacatcaaggtcgccgacatgtattccaagaagcggccggccaacatcgcgcgc
ccgcgccagatcgccatgtacctggccaaggagctgacgcagaagagcctgccggagatc
ggcgagctgttcggcggacgcgaccacaccacggtgctgcacgcggtacgcaagatcgcc
gacgagcgcagcaaggacgcccagctcaaccacgagctgcacgtgctggagcagacgctg
aagggctga

DBGET integrated database retrieval system